SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000027870 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000027870
Domain Number 1 Region: 813-985
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.85e-39
Family Ypt/Rab-GAP domain of gyp1p 0.0058
Further Details:      
 
Domain Number 2 Region: 960-1062
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.92e-31
Family Ypt/Rab-GAP domain of gyp1p 0.0052
Further Details:      
 
Domain Number 3 Region: 158-203,301-387
Classification Level Classification E-value
Superfamily PH domain-like 4.1e-27
Family Phosphotyrosine-binding domain (PTB) 0.0082
Further Details:      
 
Domain Number 4 Region: 11-148
Classification Level Classification E-value
Superfamily PH domain-like 1.13e-20
Family Phosphotyrosine-binding domain (PTB) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000027870   Gene: ENSTRUG00000011039   Transcript: ENSTRUT00000027980
Sequence length 1199
Comment pep:known_by_projection scaffold:FUGU4:scaffold_31:259752:277721:1 gene:ENSTRUG00000011039 transcript:ENSTRUT00000027980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESLAEKDNCSSKSGRRFSLTYIGWSALDRRTTLPMLPWLVAEIRRRSEKGDCGPVVQPR
EVHLVLNPPFVRCVPSSSTNSSVFIFEHKAQLISRFIHNSNDLTYFAYLLRGQPDNPESQ
MSCHVFKACDPNQVSEVICRIRQVSKSVLKGDAKPKQEADEAFYNSQKFEVLYCGKVTVM
HKKAPPTLVDDCIDKFHQHEVEQKRLRLLNGQRGSMEHNPVEFLIGGEGDKVPPSLTDRG
SFPECILEDSGFEEPQEFRTRCSSLAGSLQMKPGEGVIMGPPRRRHSSAPNHVQPSNAEK
NRTMLFQVGRFEVNLISPDSKTVVLEKNFKDISSCCQGIKHSDHFGFICRDQLDSGPSQY
VCFVFQCASESLVEEVMLTLKQAFSTAAALQSNKTEIQLCEACPIHDLHKLCERIEGLYP
PRAKIAIQKYLSQLTDNEQAEIFERVQKLKPRSDQEENELVIFHLRQLCDNKQTSHVHIG
EKVKQTLKNAVSSASGADSSASASRFKLDLLKNKARTSLTNSLENIFARLHSLKSVTEDH
LSLSSVQSQHDIFLIPLKSPASCVVCNHAGQSLPLTRSSLHLFGLEAPDEESPGPSPPGS
PPTFAENDPENGVQFRRRAHTFSHPPVKKRISFEGQSNSQSKAALHRQQSVNPELLQSSN
GEGRKRTLSSCSNDSLSWGLPPTPRRVSWRQKIFLRVASPMSKSPAPMHHPDDSKGQELL
PLSPHSRRSVMDPSRHLLPPGEKPKRTSADYRALWKTAIHQQILLLRMEKENQRLEASRD
ELHIRKMKLNYQEVGQCSKDAQALWERKLTAPGRTTVQQDKKELYHALCQGVPKNRRGEV
WLLLSYQHRLRHRLPQRLHAPDTPYQDLLKQLTAQQHAILVDLGRTFPTHQYFSAQLGAG
QLSLYNLLKAYSLLDTEVGYCQGISFVAGVLLLHMSEEQAFDMLRFLMYDLGIRQQYKPD
MISLQIQMYQLSRLLHDYHRELYTHLEDHEISPSLYAAPWFLTLFASQFPLGFVSRIFDF
VFVQGTGVIFKVALCLLSSHEGEIMECDSFESIVDYLKSTLPALSQSQMEQTIAKVVDMD
ISKQLHAYEVEYHVLQDEMLDAGAVLDDSDRLDKLEKTNMQLKRQNMDLLEKLQAARQKI
QSLETSVENFLSRESKMKHMIRSLEQEKAAYQKTIERMRSCLPLDTPTDVEMTQIKTGP
Download sequence
Identical sequences H2TT62
ENSTRUP00000027870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]