SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000027965 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000027965
Domain Number 1 Region: 247-365
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.22e-54
Family Calsequestrin 0.0000018
Further Details:      
 
Domain Number 2 Region: 145-246
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.12e-27
Family Calsequestrin 0.0000454
Further Details:      
 
Domain Number 3 Region: 22-142
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.2e-22
Family Calsequestrin 0.000023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000027965   Gene: ENSTRUG00000011077   Transcript: ENSTRUT00000028075
Sequence length 429
Comment pep:known_by_projection scaffold:FUGU4:scaffold_103:837939:842231:-1 gene:ENSTRUG00000011077 transcript:ENSTRUT00000028075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLLLFALSCLSLAPLSPAEKGLEFPQYDGKDRVVDINDKNYKKALKKHSMMCLFYHGPIP
DSKELQKQHQMTEMVLELAAQVMEEKDIGFGMVDSQKDSKVAKKLGLQEEGSTYVFKEDR
VVEFDGLLSANTLVEFLLDLLKEPVEVIGNALELRAFDRMEEDIRLVGYFKNEDSEHYEA
FKEAAEQFQPYIKFFATFDKSVAKELTLKLNEVDFYEPFMEEPLTIPGKPHTEEELVEFI
MEHRRPTLRKLRAEDMFETWEDDIEGIHIVAFAEEEDPDGFEFLEILKQVARDNTQLPEL
SIIWIDPDDFPLLIPYWEKTFKVDLFRPQIGVVNVTDADSVWLEMDDEEDLPTPQELEDW
IEDVLAGKVNTEDDDDEEEDEDEEDEHDDDDDDNNEEEDEEDDSESDDDEDDTDDEDDTD
DEEDDDDDE
Download sequence
Identical sequences H2TTF7
ENSTRUP00000027965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]