SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000027966 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000027966
Domain Number 1 Region: 306-408
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.62e-39
Family Calsequestrin 0.0000134
Further Details:      
 
Domain Number 2 Region: 24-144
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.93e-22
Family Calsequestrin 0.000023
Further Details:      
 
Domain Number 3 Region: 235-305
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.57e-16
Family Calsequestrin 0.00018
Further Details:      
 
Domain Number 4 Region: 441-470
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000241
Family Calsequestrin 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000027966
Domain Number - Region: 147-179
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.028
Family Calsequestrin 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000027966   Gene: ENSTRUG00000011077   Transcript: ENSTRUT00000028076
Sequence length 504
Comment pep:known_by_projection scaffold:FUGU4:scaffold_103:838029:842237:-1 gene:ENSTRUG00000011077 transcript:ENSTRUT00000028076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSLLLFALSCLSLAPLSPAEKGLEFPQYDGKDRVVDINDKNYKKALKKHSMMCLFYHGP
IPDSKELQKQHQMTEMVLELAAQVMEEKDIGFGMVDSQKDSKVAKKLGLQEEGSTYVFKE
DRVVEFDGLLSANTLVEFLLDLLKEPVEVIGNALELRAFDRMEEDIRLVGYFKNEDSERE
YLSFLGCEELCLALHYDRTASDPAHLCGFTAPFIPALLTQLPQFGTNSHAAPELTNYEAF
KEAAEQFQPYIKFFATFDKSVAKELTLKLNEVDFYEPFMEEPLTIPGKPHTEEELVEFIM
EHRRPTLRKLRAEDMFETWEDDIEGIHIVAFAEEEDPDGFEFLEILKQVARDNTQLPELS
IIWIDPDDFPLVSHEPFSLRQLIPYWEKTFKVDLFRPQIGVVNVTDVSQAQICQAFLQML
FTPLPTPSDFLMCVCVCVTSVQADSVWLEMDDEEDLPTPQELEDWIEDVLAGKVNTEDDD
DEEEDEDEEDEHDDDDDDNNEEED
Download sequence
Identical sequences H2TTF8
ENSTRUP00000027966 ENSTRUP00000027966 31033.ENSTRUP00000027966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]