SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000027969 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000027969
Domain Number 1 Region: 249-314,342-394
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.64e-46
Family Calsequestrin 0.00000228
Further Details:      
 
Domain Number 2 Region: 147-248
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.97e-27
Family Calsequestrin 0.0000454
Further Details:      
 
Domain Number 3 Region: 24-144
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.97e-22
Family Calsequestrin 0.000023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000027969   Gene: ENSTRUG00000011077   Transcript: ENSTRUT00000028079
Sequence length 409
Comment pep:known_by_projection scaffold:FUGU4:scaffold_103:838086:842237:-1 gene:ENSTRUG00000011077 transcript:ENSTRUT00000028079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSLLLFALSCLSLAPLSPAEKGLEFPQYDGKDRVVDINDKNYKKALKKHSMMCLFYHGP
IPDSKELQKQHQMTEMVLELAAQVMEEKDIGFGMVDSQKDSKVAKKLGLQEEGSTYVFKE
DRVVEFDGLLSANTLVEFLLDLLKEPVEVIGNALELRAFDRMEEDIRLVGYFKNEDSEHY
EAFKEAAEQFQPYIKFFATFDKSVAKELTLKLNEVDFYEPFMEEPLTIPGKPHTEEELVE
FIMEHRRPTLRKLRAEDMFETWEDDIEGIHIVAFAEEEDPDGFEFLEILKQVARDNTQLP
ELSIIWIDPDDFPLVSHEPFSLRTSHGWSCMAFHIAADSFQLIPYWEKTFKVDLFRPQIG
VVNVTDADSVWLEMDDEEDLPTPQELEDWIEDVLAGKVNTEDDDDEEED
Download sequence
Identical sequences H2TTG1
ENSTRUP00000027969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]