SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000028033 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000028033
Domain Number 1 Region: 256-558
Classification Level Classification E-value
Superfamily Kelch motif 2.88e-50
Family Kelch motif 0.0056
Further Details:      
 
Domain Number 2 Region: 655-826
Classification Level Classification E-value
Superfamily C-type lectin-like 2.45e-24
Family C-type lectin domain 0.0025
Further Details:      
 
Domain Number 3 Region: 32-154
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.13e-20
Family Spermadhesin, CUB domain 0.0018
Further Details:      
 
Domain Number 4 Region: 974-1020
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000502
Family Laminin-type module 0.018
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000028033
Domain Number - Region: 893-919
Classification Level Classification E-value
Superfamily Plexin repeat 0.00167
Family Plexin repeat 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000028033   Gene: ENSTRUG00000011106   Transcript: ENSTRUT00000028144
Sequence length 1340
Comment pep:known_by_projection scaffold:FUGU4:scaffold_81:712724:750516:-1 gene:ENSTRUG00000011106 transcript:ENSTRUT00000028144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASPAKPCDKNCLSGKCINGSCICDRGWVGDQCQHCQGRFKLTEPSGYLTDGPISYKYKTK
CTWLIEGYPNAVLRLRFNHFATECSWDHMYIYDGDSIYAPLVAVFSGLIVPELRGNETVP
EVETTSGYALLHFFSDAAYNLTGFEIFYSINSCPNNCSGHGKCAPGNSAASRVYCECDKY
WKGEACDIPYCRNNCGSPDHGYCDLTGEKLCVCNDSWQGPDCSLTVPSTESFWILPSVKP
FGTSLARASHKVVVQDKVMWVVGGYTFNYSSFQMILNYNLESGVWNTVPINSGLVPRYGH
SLAAYQDEIYMFGGKLEGGRGNVTDELWVFNVPSRTWQRRNPVVVQPAQIYAVEGHSAHC
IQTEGGDAIMLLIFGYSPIYSYISNVQEYNLKSNTWSVPETEGAVPQGGYGHTSTYDASS
GSLYVHGGYKALPANKYGLVDDLYRYNVNSRTWFILKESGFPRYLHSAVLLSGTLLIFGG
NTHNDTSLSNGAKCFSADFLAYDIACDEWRLLPKPDLHRDVNRFGHSAVVSNGSMYVFGG
FSGMLLNDVLVYRPPSCQAFVAEESCVLAGPGVRCIWSRGRCLSWEPSMANGSLIPDSFC
PTKPATVDERCYRFSDCASCTANTNGCQWCDDKKCISASSNCSSSVKNFPECPVRNEQLC
TKLANCKSCSLNLNCQWDQNQSQCHALPAQQCSEGWSQVGEACLRINSSRESYDNAQHYC
KNLNGNIASLTTPKQVDFVLEELKKLQQQDKAARMRLSPWVGLRKINVSYWGWEDMTPFT
NSSLRWLPGEPSDSGFCAYLEEPQVTGLRANPCTATAHGLICEKATGNPSQSSRPSCKKP
CSLHSNCANCTSQGMECMWCSSAQRCVDSTAYVISFPYGQCLEWQTGDCVAQNCSGLRTC
SQCLEQPECGWCGDPSSTGKGLCMEGSYRGPMKRPAKQGQPVQAHHQPQDMSLELNSCPR
EKGFEWAFIQCPACQCNGHSTCVNSSVCEQCRNLTTGPNCQTCMPGYHGDPTNGGKCQAC
KCNGHANVCQVLTGKCFCTTKGIKGDQCQLCDSENRYLGNPLRGTCYYNLLIDYQFTFSL
IQEDDNHYTAINFMASPEQANKNLDMSINASNNFNLNITWSVGSTAGTISGEEVPIVSKT
NIKEYKDSFSCEKFTFRSNPNITFYVYVSNFSWPIKIQIAFSQHNNIMDLVQFFVTFFSC
FLSLLLVAAVVWKIKQTCWASRRREQLMRERQQMASRPFASVAVALDATAERMDLMQPVV
DGAPKPVAMEPCSGGKAAVLTVLLHLPSGPSGLPPPGQSGLIVASALVDVSQQKPSDFKD
KTQSLKNRKALPPALQGTCV
Download sequence
Identical sequences H2TTM5
ENSTRUP00000028033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]