SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000029258 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000029258
Domain Number 1 Region: 154-446
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.41e-87
Family Nuclear receptor ligand-binding domain 0.0000000174
Further Details:      
 
Domain Number 2 Region: 47-134
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.12e-28
Family Nuclear receptor 0.0000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000029258   Gene: ENSTRUG00000011576   Transcript: ENSTRUT00000029375
Sequence length 451
Comment pep:known_by_projection scaffold:FUGU4:scaffold_169:507503:514641:-1 gene:ENSTRUG00000011576 transcript:ENSTRUT00000029375 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSVVKQWCQSQYNMYFSPLYLFLCLVMDSTVVSTSSLPPDEFDRNVPRICGVCGDKATGF
HFNAMTCEGCKGFFRRSMKRKASFTCPFNGSCTITKDNRRHCQACRLKRCVDIGMMKEFI
LTDEEVQRKKDLIQRRKDEEAQREAEREARRPRLTDEQSQVIATLVEAHHKTYDESYSDF
RRFRPPVREGPVTRSASRAASLHSLSDASSDSFSHSPESVDNKLNFNNLLMMYHEQGSSP
ESSEEEASSFSMLPHLADLVSYSIQKVIGFAKMIPGFRELTAEDQIALLKSSAIEVIMLR
SNQSFNLEDMSWSCGGPDFKYRISDVTKAGHTLELLEPLVKFQVGLKKLNLQEEEHVLLM
AICLLSPDRPGVQDHARVEALQDRLSETLQAYIRLHHPGGRLLYAKMIQKLADLRSLNEE
HSKQYRSLSFQPEHSMQLTPLVLEVFGSEVS
Download sequence
Identical sequences H2TX49
ENSTRUP00000029258 31033.ENSTRUP00000029258 ENSTRUP00000029258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]