SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000029259 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000029259
Domain Number 1 Region: 128-425
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.77e-87
Family Nuclear receptor ligand-binding domain 0.0000000184
Further Details:      
 
Domain Number 2 Region: 21-108
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.89e-29
Family Nuclear receptor 0.0000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000029259   Gene: ENSTRUG00000011576   Transcript: ENSTRUT00000029376
Sequence length 430
Comment pep:known_by_projection scaffold:FUGU4:scaffold_169:507503:514563:-1 gene:ENSTRUG00000011576 transcript:ENSTRUT00000029376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSTVVSTSSLPPDEFDRNVPRICGVCGDKATGFHFNAMTCEGCKGFFRRSMKRKASFTC
PFNGSCTITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKKDLIQRRKDEEAQREAE
REARRPRLTDEQSQVIATLVEAHHKTYDESYSDFRRFRPPVREGPVTRSASRAASLHSLS
DASSDSFSHSPGFVTKESVDNKLNFNNLLMMYHEQGSSPESSEEEASSFSMLPHLADLVS
YSIQKVIGFAKMIPGFRELTAEDQIALLKSSAIEVIMLRSNQSFNLEDMSWSCGGPDFKY
RISDVTKAGHTLELLEPLVKFQVGLKKLNLQEEEHVLLMAICLLSPDRPGVQDHARVEAL
QDRLSETLQAYIRLHHPGGRLLYAKMIQKLADLRSLNEEHSKQYRSLSFQPEHSMQLTPL
VLEVFGSEVS
Download sequence
Identical sequences H2TX50
ENSTRUP00000029259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]