SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000030103 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000030103
Domain Number 1 Region: 136-427
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.62e-87
Family Nuclear receptor ligand-binding domain 0.0000000205
Further Details:      
 
Domain Number 2 Region: 33-121
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.71e-29
Family Nuclear receptor 0.00000837
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000030103   Gene: ENSTRUG00000011907   Transcript: ENSTRUT00000030220
Sequence length 432
Comment pep:known_by_projection scaffold:FUGU4:scaffold_118:585753:595938:1 gene:ENSTRUG00000011907 transcript:ENSTRUT00000030220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPSNSPCSMSVMEPMTVTTSVVGPQEFDRNAPRICGVCGDKATGFHFNAMTCEGCKGFF
RRSMKRKASFTCPFNGSCTITKDNRRHCQACRLKRCIDIGMMKEFILTDEEVQRKKEMIL
KRKEEEAAREATKPRLNEEQARIISSLVEAHHKTYDTSYSDFSRFRPPVRERPVTRSASR
AASLHSLSDASSDSLNHSPESMDTKLNLSNLLMMYQDGVSSPDSSEEETKLSMLPHLADL
VSYSIQKVIGFAKMIPGFRDLTAEDQIALLKSSAIEIIMLRSNQSFSLEDMSWSCGGPDF
KYCITDVTKAGHTLELLEPLVKFQVGLKKLNLHEEEHVLLMAICLLSPDRPGVQDHRHVE
KLQDHLSEILQAYIRVNHPGGRLLYAKMIQKLADLRSLNEEHSKQYRSLSFQPEHSMQLT
PLVLEVFGSEVS
Download sequence
Identical sequences H2TZJ4
ENSTRUP00000030103 31033.ENSTRUP00000030103 ENSTRUP00000030103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]