SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000030289 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000030289
Domain Number 1 Region: 370-553
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.31e-68
Family SPRY domain 0.00000634
Further Details:      
 
Domain Number 2 Region: 14-83
Classification Level Classification E-value
Superfamily RING/U-box 1.89e-19
Family RING finger domain, C3HC4 0.0052
Further Details:      
 
Domain Number 3 Region: 165-207
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000116
Family B-box zinc-binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000030289   Gene: ENSTRUG00000011968   Transcript: ENSTRUT00000030406
Sequence length 556
Comment pep:novel scaffold:FUGU4:scaffold_98:594473:599036:-1 gene:ENSTRUG00000011968 transcript:ENSTRUT00000030406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKCPSTPDGRLLSDEQFQCSICLDLFTNPSSTPCGHSFCLGCISEYWSSAKVCRCPLCKK
TFQKRPNLQINRTLREITEQFKAMRRGGGPVTGKRGDGGNPCTFVYPHTGFIPTQPQPAQ
CPEPCLQTPSATSSHIGFQRTETIHSDHSCRQPPSLPGPPQRITGSHFMIAIIYCKNDRV
CICPDCETEDHYDHDTVTIKQEWLEKKVGTGTKKITGDQEMIRQRIRKMEEIRESVSNVK
VELETEMAGSICLFSALMSAIERTQVELIELMEMSQKAVEKQAEAALKKLEQENKELQRR
VSALEELAQSDDFTHCIKTFPSLILPPPVQDWSAVSIGTYLGTKNIYRKLAVQVERFNQE
LKNVAEKGMKRLQEYAVDVTLDVNTAHPRLIISDDMKSVWCGDQHQLLPDNQERFDRIIC
VLGREMMSSGRHYWEVDVTGKTDWDLGVARKSVSRKGKITVTPGNGYWFLSLRDKERYAF
HTVHSSDVHLNLQPHKIGIFVDFENGQVSFYNVNAQLHIYTFNDSFSDSIYPFFSPCSNK
YGKNDEPLTITPVNMI
Download sequence
Identical sequences H2U030
ENSTRUP00000030289 31033.ENSTRUP00000030289 ENSTRUP00000030289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]