SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000030785 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000030785
Domain Number 1 Region: 194-397
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-50
Family DBL homology domain (DH-domain) 0.000000338
Further Details:      
 
Domain Number 2 Region: 2-230
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.01e-41
Family Calponin-homology domain, CH-domain 0.0035
Further Details:      
 
Domain Number 3 Region: 383-544
Classification Level Classification E-value
Superfamily PH domain-like 6.76e-30
Family Pleckstrin-homology domain (PH domain) 0.0063
Further Details:      
 
Domain Number 4 Region: 642-772
Classification Level Classification E-value
Superfamily SH2 domain 4.01e-26
Family SH2 domain 0.00066
Further Details:      
 
Domain Number 5 Region: 796-850
Classification Level Classification E-value
Superfamily SH3-domain 4.46e-22
Family SH3-domain 0.00065
Further Details:      
 
Domain Number 6 Region: 588-671
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000353
Family SH3-domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000030785   Gene: ENSTRUG00000012168   Transcript: ENSTRUT00000030902
Sequence length 851
Comment pep:known_by_projection scaffold:FUGU4:scaffold_90:833734:867076:1 gene:ENSTRUG00000012168 transcript:ENSTRUT00000030902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYWRQCAMWLISCNVLPKNHRVVADRAQVFDLAQTLRDGVLLCQLLNNLRPHTINLKEI
NLRPQMSQFLCLKNIRTFLTSCNVAFAMKKIDLFDAFDLFDVRDFGKVMDTLSRLSHTVI
AQQGGSKPFPTEESLKDEDIYNNLEDLIDENAPEDEDDLYAAVYGMDDNCTGGKIYEDLM
RAEQPPPLVLTQAELDVRTCCLSEIKQTEEKYTETLESIEKYFLNPLKKFISAAEIDRVF
INIPDLVKVHRSLFLDVQDSILNKNASNLYQIFISYKERLLVYGIYCSQVEVAIVVLDQI
CKEKEDVRLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTHDATDKSNLK
VALDAMRDLAQFINEVKRDNETLREINQYQRSIENLNQPLITYGRPRGDGEVRMVSSVDK
RKQYRHIFLFDVAAIVCKRRGDNYEMKDVLDLHCFKVTNNPTSDREGKKWCYGFYVTHQQ
GHTGFELFFKTRELKKKWLDRFEMAISDIRPEKANHNSHQFKMHTFEKITSCSFCHLLLR
GIFNQGYLCLKCGLETHKECLGQLGVCGRTEKHECEIFHSPEEPKRSTSLKKSSFQFSSP
GLPRLVVIRAYSGIPSPHCGPPLSIHEGDVIELLLADLHSSWWQGKILATSKIGFFPSDA
VRPCPCVPKPVDYSSQLWFAGPMERCQAELELSDRDNSTFLVRHRSKECTEYALSIKFND
KVKHIKILTKDGCFYIAESRLFKTVADLVEYYKQYSLKEGFRGLDTTLQVPYREPSEPSY
QRGKKVGKSVFSPRVMAVAVARYDFASRDTQELSLLKGDIIRVYTKLPDGWWKGEVDGRV
GWFPSTYVEED
Download sequence
Identical sequences H2U1H4
31033.ENSTRUP00000030785 ENSTRUP00000030785 ENSTRUP00000030785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]