SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000030789 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000030789
Domain Number 1 Region: 194-397
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-50
Family DBL homology domain (DH-domain) 0.000000338
Further Details:      
 
Domain Number 2 Region: 2-230
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.88e-41
Family Calponin-homology domain, CH-domain 0.0035
Further Details:      
 
Domain Number 3 Region: 383-544
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-31
Family Pleckstrin-homology domain (PH domain) 0.0063
Further Details:      
 
Domain Number 4 Region: 660-766
Classification Level Classification E-value
Superfamily SH2 domain 1.62e-25
Family SH2 domain 0.00074
Further Details:      
 
Domain Number 5 Region: 786-840
Classification Level Classification E-value
Superfamily SH3-domain 4.73e-22
Family SH3-domain 0.00065
Further Details:      
 
Domain Number 6 Region: 581-653
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000748
Family SH3-domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000030789   Gene: ENSTRUG00000012168   Transcript: ENSTRUT00000030906
Sequence length 841
Comment pep:known_by_projection scaffold:FUGU4:scaffold_90:833734:867076:1 gene:ENSTRUG00000012168 transcript:ENSTRUT00000030906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYWRQCAMWLISCNVLPKNHRVVADRAQVFDLAQTLRDGVLLCQLLNNLRPHTINLKEI
NLRPQMSQFLCLKNIRTFLTSCNVAFAMKKIDLFDAFDLFDVRDFGKVMDTLSRLSHTVI
AQQGGSKPFPTEESLKDEDIYNNLEDLIDENAPEDEDDLYAAVYGMDDNCTGGKIYEDLM
RAEQPPPLVLTQAELDVRTCCLSEIKQTEEKYTETLESIEKYFLNPLKKFISAAEIDRVF
INIPDLVKVHRSLFLDVQDSILNKNASNLYQIFISYKERLLVYGIYCSQVEVAIVVLDQI
CKEKEDVRLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTHDATDKSNLK
VALDAMRDLAQFINEVKRDNETLREINQYQRSIENLNQPLITYGRPRGDGEVRMVSSVDK
RKQDRHIFLFDVAAIVCKRRGDNYEMKDVLDLHCFKVTNNPTSDREGKKWCYGFYVTHQQ
GHTGFELFFKTRELKKKWLDRFEMAISDIRPEKANHNSHQFKMHTFEKITSCSFCHLLLR
GIFNQGYLCLKCGLETHKECLGQLGVCGRTGTETIDVFKFSSPGLPRLVVIRAYSGIPSP
HCGPPLSIHEGDVIELLLADLHSSWWQGKILATSKIGFFPSDAVRPCPCNNHSAFLRQVP
KPVDYSSQLWFAGPMERCQAELELSDRDNSTFLVRHRSKECTEYALSIKFNDKVKHIKIL
TKDGCFYIAESRLFKTVADLVEYYKQYSLKEGFRGLDTTLQVPYREPSEENRSITKAGSV
FSPRVMAVAVARYDFASRDTQELSLLKGDIIRVYTKLPDGWWKGEVDGRVGWFPSTYVEE
D
Download sequence
Identical sequences H2U1H8
ENSTRUP00000030789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]