SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000030791 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000030791
Domain Number 1 Region: 100-303
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.18e-50
Family DBL homology domain (DH-domain) 0.000000338
Further Details:      
 
Domain Number 2 Region: 289-450
Classification Level Classification E-value
Superfamily PH domain-like 5.53e-30
Family Pleckstrin-homology domain (PH domain) 0.0063
Further Details:      
 
Domain Number 3 Region: 545-675
Classification Level Classification E-value
Superfamily SH2 domain 3.32e-26
Family SH2 domain 0.00066
Further Details:      
 
Domain Number 4 Region: 697-751
Classification Level Classification E-value
Superfamily SH3-domain 4.07e-22
Family SH3-domain 0.00065
Further Details:      
 
Domain Number 5 Region: 500-574
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000015
Family SH3-domain 0.00057
Further Details:      
 
Domain Number 6 Region: 5-136
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000116
Family Calponin-homology domain, CH-domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000030791   Gene: ENSTRUG00000012168   Transcript: ENSTRUT00000030908
Sequence length 752
Comment pep:known_by_projection scaffold:FUGU4:scaffold_90:837771:867076:1 gene:ENSTRUG00000012168 transcript:ENSTRUT00000030908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQSYCRLHLQQLKVMDTLSRLSHTVIAQQGGSKPFPTEESLKDEDIYNNLEDLIDENAPE
DEDDLYAAVYGMDDNCTGGKIYEDLMRAEQPPPLVLTQAELDVRTCCLSEIKQTEEKYTE
TLESIEKYFLNPLKKFISAAEIDRVFINIPDLVKVHRSLFLDVQDSILNKNASNLYQIFI
SYKERLLVYGIYCSQVEVAIVVLDQICKEKEDVRLKLEECSKRANNGKFTLRDLLVVPMQ
RVLKYHLLLQELVKHTHDATDKSNLKVALDAMRDLAQFINEVKRDNETLREINQYQRSIE
NLNQPLITYGRPRGDGEVRMVSSVDKRKQYRHIFLFDVAAIVCKRRGDNYEMKDVLDLHC
FKVTNNPTSDREGKKWCYGFYVTHQQGHTGFELFFKTRELKKKWLDRFEMAISDIRPEKA
NHNSHQFKMHTFEKITSCSFCHLLLRGIFNQGYLCLKCGLETHKECLGQLGVCGRTVSAS
HPAAESAKPRPKGFRNDPKFSSPGLPRLVVIRAYSGIPSPHCGPPLSIHEGDVIELLLAD
LHSSWWQGKILATSKIGFFPSDAVRPCPCVPKPVDYSSQLWFAGPMERCQAELELSDRDN
STFLVRHRSKECTEYALSIKFNDKVKHIKILTKDGCFYIAESRLFKTVADLVEYYKQYSL
KEGFRGLDTTLQVPYREPSEENRSITKAGSVFSPRVMAVAVARYDFASRDTQELSLLKGD
IIRVYTKLPDGWWKGEVDGRVGWFPSTYVEED
Download sequence
Identical sequences H2U1I0
ENSTRUP00000030791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]