SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000031932 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000031932
Domain Number 1 Region: 393-557
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.23e-48
Family SPRY domain 0.00013
Further Details:      
 
Domain Number 2 Region: 3-80
Classification Level Classification E-value
Superfamily RING/U-box 1.51e-16
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 3 Region: 141-206
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000183
Family B-box zinc-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000031932   Gene: ENSTRUG00000012616   Transcript: ENSTRUT00000032055
Sequence length 567
Comment pep:novel scaffold:FUGU4:scaffold_118:678184:681155:1 gene:ENSTRUG00000012616 transcript:ENSTRUT00000032055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KPVEHLVNELSCPICFQLFCDPVVLPCGHNYCRTCIWTTASPASKSGQTPPCCPECRGKF
QDVESLQKNFKLCNIVEGFRASASHLERHFHTESEKMEVFCDHCIDEPSVAVKSCLKCEV
LLCSRHLQKHQEKESFRSHLLVDPLSELGMKSCTCHHRPLEYFCSSDMNLLCATCFIEGH
HQNHDILTFTAAEEEMRRALQSRCEKMALDQGVSEATSDKMANKAITLMDSIAALVERYR
ERLHDLLEEEGSQYRKSWQLGLSSLEQQQHHLMDAQNTAKQVLMETDTCIFIQSIPFTCT
HTHTHTHTHTHTDAHTHIDNAFIIIGKDIFCLCRFLLIDEKMREVITSNSSSQIPPKNPF
NGKHLQASLKTQDFRLEMTHLLDSLHILLNPMELTFNLCTAHPSLLVSNDLHTVKYTPTK
QLYPEHPERFTSAPQILCTKGFSGGEHIWVVEVGANAMWSLGICYKSIPRCGDHSRLGHN
SVSWRLQWKNSKLTVCQSSCNVALVEVKNHPQRVEIALDYEGGVLTFHSTKGHREHLYTF
RTVFREPVYPAFSIHSNTPDSWISLQS
Download sequence
Identical sequences H2U4S0
ENSTRUP00000031932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]