SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000032438 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000032438
Domain Number 1 Region: 299-522
Classification Level Classification E-value
Superfamily SIS domain 1.68e-24
Family mono-SIS domain 0.00078
Further Details:      
 
Domain Number 2 Region: 30-176
Classification Level Classification E-value
Superfamily SIS domain 0.0000000423
Family mono-SIS domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000032438   Gene: ENSTRUG00000012817   Transcript: ENSTRUT00000032562
Sequence length 595
Comment pep:known_by_projection scaffold:FUGU4:scaffold_64:713339:722055:1 gene:ENSTRUG00000012817 transcript:ENSTRUT00000032562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WRGSTDSCVMKGPDRTWESPDYEPSLPVSEKSNPLTRDIDQASAIGIVRMLQACDGQMFE
EDTAVKYQRLLSKQVVQTLVEVAKRVELILKDPQDSLVVLSGCGTSGRIAFLVASRFSRR
LKDVNQSSVYSYIIAGGDRALLSSQEAPEDDAKLGRLMLKEACEGKKRVVFIGVSCGLSA
PFVAGQLDFCLRHPEVFTPVLVGFNPAHQARDEPIEGCTFTFRSVVQRMLELAQSQRAFI
ISPAVGPEAISGSSRMKGGSATKILLEVILSTAQAAAFSRAPLTETVTLQYLLAYKNAVD
VTYSRTEQISTLVEAAGKSLRCGGRVCYLGWGTLAVLGLIDASECNPTFGADYEDIRGFI
AGGYVELDNNEGPLTSLGPDFSISHEEFFRSVLPSLTDRDTVLLLYTHSDDLGEVAALAR
RVRERTSSLHAIYHRGGGDNAATDRQVTVCPPACPSVCLSVIYLPMFVQEQWELSTKLLL
NAISTGGHVLKGKVYRNHMVDVQVTNSKLYRRAARLLQKLSGHPKSRCEEALLKAIYQSE
QLTSAIPLSDVRAHTAAANHRSRVVPLALILLLTNCSLKEAESRLEQQPIIREVV
Download sequence
Identical sequences H2U672
ENSTRUP00000032438 ENSTRUP00000032438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]