SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000032439 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000032439
Domain Number 1 Region: 298-522
Classification Level Classification E-value
Superfamily SIS domain 7.17e-23
Family mono-SIS domain 0.00074
Further Details:      
 
Domain Number 2 Region: 29-175
Classification Level Classification E-value
Superfamily SIS domain 0.0000000423
Family mono-SIS domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000032439   Gene: ENSTRUG00000012817   Transcript: ENSTRUT00000032563
Sequence length 595
Comment pep:known_by_projection scaffold:FUGU4:scaffold_64:713430:722055:1 gene:ENSTRUG00000012817 transcript:ENSTRUT00000032563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRFQTLVATVEMPRYTVLDYEPSLPVSEKSNPLTRDIDQASAIGIVRMLQACDGQMFEE
DTAVKYQRLLSKQVVQTLVEVAKRVELILKDPQDSLVVLSGCGTSGRIAFLVASRFSRRL
KDVNQSSVYSYIIAGGDRALLSSQEAPEDDAKLGRLMLKEACEGKKRVVFIGVSCGLSAP
FVAGQLDFCLRHPEVFTPVLVGFNPAHQARDEPIEGCTFTFRSVVQRMLELAQSQRAFII
SPAVGPEAISGSSRMKGGSATKILLEVILSTAQAAAFSRAPLTETVTLQYLLAYKNAVDV
TYSRTEQISTLVEAAGKSLRCGGRVCYLGWGTLAVLGLIDASECNPTFGADYEDIRGFIA
GGYVELDNNEGPLTSLGPDFSISHEEFFRSVLPSLTDRDTVLLLYTHSDDLGEVAALARR
VRERTSSLHAIYHRGGGDNAATDRQEVIDNLCSSALKISWPSPQTRISVHQWELSTKLLL
NAISTGGHVLKGKVYRNHMVDVQVTNSKLYRRAARLLQKLSGHPKSRCEEALLKAIYQSE
QLTSAIPLSDVRAHTAAANHRSRVVPLALILLLTNCSLKEAESRLEQQPIIREVV
Download sequence
Identical sequences H2U673
ENSTRUP00000032439 ENSTRUP00000032439 31033.ENSTRUP00000032439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]