SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000033344 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000033344
Domain Number 1 Region: 489-600
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-30
Family SH2 domain 0.00000232
Further Details:      
 
Domain Number 2 Region: 170-264
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.66e-28
Family Ras-binding domain, RBD 0.00021
Further Details:      
 
Domain Number 3 Region: 295-407
Classification Level Classification E-value
Superfamily PH domain-like 5.75e-17
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000033344   Gene: ENSTRUG00000013116   Transcript: ENSTRUT00000033470
Sequence length 604
Comment pep:known_by_projection scaffold:FUGU4:scaffold_12:771016:793027:-1 gene:ENSTRUG00000013116 transcript:ENSTRUT00000033470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALAGCPEYFLHHSNYKESMDRTSSRRSDGLIVPSFQRQANQNLPHHHDDDVDLEQLVND
MNSSMESVYSTQADTTLLLNNGHAHTPNHHHHHHHQPGYPGPGQAHRRHTPTIAASSPSR
DRLRHSQPMHIQAVRCLREEQQLRPASLPAIPNPFPELCSPAGSPVLSPTQASNNHIVKV
WSEDGAGKVVEIPADMTARDVCQLLVYKNHCLDDNAWTLVEHHPILGLERCLEDHELVAQ
IQASMSSDSKFLFRKNYAKYEFFRNPLNFFPEQMVAWCQDSNGSIPQSQLLQNFLNSSSC
PEIQGYLHLKEPGRRSWKKLYMFLRRSGLYYSTKGTSKEPRHLQLLSDLDDSSIFTVITG
RKLHNAPTDFQFCIKPSKARSDCKELKMLCAEDEQSRTCWMTAFRLLKVGDPPVNVVRIT
QRVSKLISTESPPQRSVSENSLVAMDFSGRTGRVIDNPVEAQSAALEEGQTWRKRSQRMN
VLGSPSPMHPSSLSTVIHRTQVWFHGRIMREEAHKMIIQQGQVDGLFLLRDSQSNPKAFV
LTLCHHQKIKHFQILPCEEDGQVFFSLDDGATKFTDLIHLVEFYQLNRGVLPCKLKHPCT
AVAL
Download sequence
Identical sequences H2U8S8
ENSTRUP00000033344 ENSTRUP00000033344 31033.ENSTRUP00000033344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]