SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000033348 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000033348
Domain Number 1 Region: 389-500
Classification Level Classification E-value
Superfamily SH2 domain 1.12e-30
Family SH2 domain 0.00000232
Further Details:      
 
Domain Number 2 Region: 65-158
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.96e-28
Family Ras-binding domain, RBD 0.00021
Further Details:      
 
Domain Number 3 Region: 189-301
Classification Level Classification E-value
Superfamily PH domain-like 4.38e-17
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000033348   Gene: ENSTRUG00000013116   Transcript: ENSTRUT00000033474
Sequence length 504
Comment pep:known_by_projection scaffold:FUGU4:scaffold_12:771016:786125:-1 gene:ENSTRUG00000013116 transcript:ENSTRUT00000033474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPSRDRLRHSQPMHIQAVRCLREEQQLRPASLPAIPNPFPELCSPAGSPVLSPTQASNNH
IIPRNTLQPSIVKVWSEDGAGKVVEIPADMTARDVCQLLVYKNHCLDDNAWTLVEHHPIL
GLERCLEDHELVAQIQASMSSDSKFLFRKNYAKYEFFRNPLNFFPEQMVAWCQDSNGSIP
QSQLLQNFLNSSSCPEIQGYLHLKEPGRRSWKKLYMFLRRSGLYYSTKGTSKEPRHLQLL
SDLDDSSIFTVITGRKLHNAPTDFQFCIKPSKARSDCKELKMLCAEDEQSRTCWMTAFRL
LKVGDPPVNVVRITQRVSKPLSTPPPPSLLPQRSVSENSLVAMDFSGRTGRVIDNPVEAQ
SAALEEGQTWRLQKRSQRMNVLGSPSPMHPSSLSTVIHRTQVWFHGRIMREEAHKMIIQQ
GQVDGLFLLRDSQSNPKAFVLTLCHHQKIKHFQILPCEEDGQVFFSLDDGATKFTDLIHL
VEFYQLNRGVLPCKLKHPCTAVAL
Download sequence
Identical sequences H2U8T2
ENSTRUP00000033348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]