SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000034124 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000034124
Domain Number 1 Region: 3066-3376
Classification Level Classification E-value
Superfamily BEACH domain 2.75e-111
Family BEACH domain 0.000000134
Further Details:      
 
Domain Number 2 Region: 3493-3740
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.73e-33
Family WD40-repeat 0.003
Further Details:      
 
Domain Number 3 Region: 2966-3069
Classification Level Classification E-value
Superfamily PH domain-like 3.07e-23
Family PreBEACH PH-like domain 0.011
Further Details:      
 
Domain Number 4 Region: 278-456,736-800,848-887
Classification Level Classification E-value
Superfamily ARM repeat 0.0000207
Family GUN4-associated domain 0.089
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000034124
Domain Number - Region: 1426-1453,1482-1625
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0222
Family Clostridium neurotoxins, the second last domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000034124   Gene: ENSTRUG00000013388   Transcript: ENSTRUT00000034250
Sequence length 3755
Comment pep:known_by_projection scaffold:FUGU4:scaffold_469:66334:92364:1 gene:ENSTRUG00000013388 transcript:ENSTRUT00000034250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGASNTLAREFLTDVHQLCSAVAQRAETREEDEEESHMVALGEYLVRGRGFLLLSTLDS
IIDQELTCREELLTLLLSLLPLVWKIPVREEKAPDFTLPSLLEVFLRRDVKNSPLREGKK
PAADELNSSKRSRFGSGTWKSRQSRRTAQKYSVKDARKSQVSTSDSEENPDCKAAAGHGS
GSGRRTRGSTVRVSCQHHRPEPFVATSTTVPADTMSAPHLHPRAPGPLMMDVETLTDPAA
VSIFNRMENSPFDLCHVILSLLEKVCKFDLNLNHNPGLAVSVVPTLTEILAEFGECCAPG
GGSGGGAGIEEVARGWGEEPIALIQRMLLRTILHLMSVDISQSETLSDSLRRSLTDLLRA
TLRIRSCLDRQTNPFAPRLKKTLQEVQEEFSFSRHRHRALLLPELLDGVLQVLLSCLQAS
TSNPFFFSQALELIHEFVQHCGLDLFETTVLRLEGLSRATDTEIVGEATERLRGLIAGVF
KITSAIKKAKSEQLHQSVCARRRHRRCEYSHFLHHHRDLSGLPVSAFKQAARRNPFEEDG
DGKGESEGYAARYPERCCCLAACAHQCLRLLQRLSPSGPAVLQVLAGVQAVGICCCMDPR
SVIGPLLHAFQAPALRAYQANVLSVLGRLILEQLGGGQPSEKAKLASCNICTLDSSQLLG
LEETLQQGHTLSVSSTLCYRSQGILPSGGGAEDMLWKWDALEAYQQLVFGEDWQLSQQIA
GHVCHLTLRGNAVVQWQLYTHILNPVLQRGVELAHHAQQLGVSAVCTQVCSYHTRCLPVD
ILLIYLQTLPSLLKSRVIRDLFLSCNGLNQVTELVYLDQTRSLALKVFETLIIGSGLYQM
GGMLQELQSTDAEEREAILGLAEELRYQGAGEGPQSLSKFYEGLKEKYPCYKNRSQAETH
LHVINLFLCVAFLCVSKEGDSDRDSANESEDTSGYDSTASEPLGGRLPYLSPDSIVLPSK
EQTRRAADVWTVCQWIYLSSPLFQRQFFKLGGLDVCLRLMTMVIQKLSCKSKDGKPKKRR
EGKPKCSPESTGLAVEPEQEETCSESAGLADTKSKDPERKLEEEWQLQSIRLLEALLAIC
LHSSNSTFQKTEPELSCQLQSVEETLLEVRDQLSCSGVVNSDLAIPLFDSLLRVALAQAS
SSPDAPEEKPERKPQVLAEGAVQAGDLSEEVDEAQSCGNKPLGEEEGYDADSESNPGDMA
KQEEGLKLQREPCQQWTRGNFRILENLLVLMLGVLLFPEICTMQLHLLTTGSPDLEVLNH
VFHSLLGAVQANQRNATLLYNQGGVKTILSGFHDILSQTDPSFTDCQTVLVELLVAMVSQ
RITAEELALLIRLFLEKTPPTDVLLKGIQLIVEANMNLEPLHLLTFPVILGATPGSVSAS
FRQNGSTGGKNVSLLWKGMLSPGRGEGDGERRPSHMCFSPWHAAPLHLPLVGQNCWPHMA
NGFSVSMWLRVAEQDRDKSKEERNPPAAQPHHGCAQAGPRQVEEGLSHILSMGSKALMFQ
VWADFSTGSLTFRICIDPNDEVKAGLLAQAESGVKLLKPGQWQHMGLTYTQQPEGKKNTL
GRVVVWVCGIRKCEVSLVYSLPRKSSLSSDSNKTFCMLGHCMQTSGELMKEGKCWSMGTV
LLFNGSRIGTEEALYLYTSGPDLTSIMPCKYGKPSGIFTKFVTEDSLRSEHVRDLFLKNK
DLDTAALVESLAVVYAPSNPRVYTIYEPVIRLKGQAKTVVTQRPFSSKEVQSLSLEPSAL
RALLPTETQGLQSVLHKIGGLGTFVFLYARTVELSDCERTQALALQVLLSLAKFNQHRIQ
EMDCYHGYSMIHQVLIKSKCIVGFHVLKTLLDGCCSRPVLVLGDDGQFRLDTDSVAVVQD
VRLLSDVLLDWKIWAKAECRVWETLLTALEVLIRVHHPHQVFNIRQFLKAEIVHRFLLTC
QVLQEHRDEHLTAIPQEVCLSFVRIIQEVLGSPPDLELLKLISSFLLAVHPPTNTYVCHT
PASFYFSLHTDGKLHQEKVQSIMYLRHPSSGGKSPCSSVASLSPTVFTDAPHEEIAAMNV
YAAGGGALTMNRRVAKGRTTFLVLLGASPLPTPRLGHVNSNEAGEGDGSSLATLGSTETL
KKGGDELLLSSCESAKTICSKDAGGEASLRTPSISVEEDRDDATEVDSLADGSVGVAASE
DRFDWATEETPPRPDSLKGIRSFQRSPSNLASLGLAFPAPNGSLAISRWPSAAERGSVPE
DWESYTYSPGYERARSKTSESNDSTEDCLVLICCGLYDLLRGILLLLPDLMLEEVMDKLI
QPEALIVLVNHPSPLIQQGVMKLLDAYFSRALKEQKEKFLKTHGFSLLANQLYTHKGNQG
LLECFLEMLFGRPVSLEEDLDLEEMDTISPFRKRCIIPVLGLIENSLYENALAHNLLCML
LQLLNACPKLADILLDHGLLYVLFNTLSTLNGMEMGIPLNDYKLLVCDIQQLLVAVTIHS
CSSSGSQYFRIIEDLITLLGFMQTSKIRRTQEMAVALQFRVLQSAIEFIKTTANQDPQKL
SSSVNAPSSPHPAVDQKRRSIAGRFSLAQTDSLLMRMRSVASDELHQMMQRRMSQENPIR
ASETEFVQRLQKLVVLAVNRLLYHDVSQDFFDLLNIPDSPDQQLFPAEPHESGSASVPHS
PGPFNLPPASKKSFQKAVLKLMMDGIKTSLGSTGRGGAPHHQWRRILWSCRDTFRVQIGR
LLVHTLSPALPLTDRKEALEFVFDARHLDILKESLSPSLEHGPKLSLYLHEMLHDHKDSL
TKDDQNAVGVFMTSLKLCGHRCIPPNAAHKQDLLKAIKEEKLKYETEERTSRAAWEKKLV
NTQRNLISRLDGKSKDISKIAADITQNVSLQQGMERKKVIQHIRGLYKIDLSASRHWQEL
VQQLTHDRAVWNDSSSYPTSWQLDATEGPNRERRRLQRCYLTIPNKYLLRDRRKAEDPAK
AALSFLFEDKTHSSFSSTVKDKATSESIRFTRRCVSVAPSRETSGELLLGKSGMYFVEDN
AADAHDSQSLHGETEAPSFSWTYEEIKEVHKRWWQLRDNAVEIFLTNGRTLLLAFDNTKF
RDDVFHNILTSDLPNLLEHGNITALTHLWSSGQISNFEYLTHLNKHAGRSFNDLMQYPVF
PFILRDYTSETLDLQDASIYRNLSKPIAVQSKEKEDRYVDNYRYLEEEYKKGVREDDPMP
PVQPYHYGSHYSNSGTVLHFLVRMPPFTKMFLAYQDQSFDIPDRTFHSMNTTWRLSSYES
MTDVKELIPEFFYLPEFLVNREGFDFGVRQNGERVNHVNLPPWARNDPRLFILIHRQALE
SDQVSQTLCQWIDLVFGLKQKGKAAVQAINVFHPATYFGMDVSAVEDPVQRRALETMIKT
YGQTPRQLFSGSHVSRAASRVLMEGELPAAMGLLVQLAFRESREQTKEITCPSPLPWIKG
LKWGEYVGSPSTPDPVVCFSQPHGERFGSLLALPTRAICGLSRKFCLMMIYSKEQGVRSM
HSTDIQWSAILSWGYADNILRLKSKQSEPPINFIQCSQLHQVTSCAWVPDGCQLFTGSEC
GVITAYSNRFTNTTPSEMEVESQVHLYGHTAQVTGLFVCKPYSVLVSVSNDGTCILWDLN
RLCYVQSLAGHKSPVTAVSASETSGDIATVCDSVGGGSDLRLWTVNGDLIGHVHCREIIC
SVAFSNQPEGMSVNVIAGGLENGVVRLWSTWDLKPVREITFPKSSRPIISLTYSCDGHHL
YTANSEGTVMAWCRRDQQRMKLPMFYSFLSSYAAG
Download sequence
Identical sequences H2UB06
31033.ENSTRUP00000034124 ENSTRUP00000034124 ENSTRUP00000034124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]