SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000034126 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000034126
Domain Number 1 Region: 3058-3368
Classification Level Classification E-value
Superfamily BEACH domain 2.75e-111
Family BEACH domain 0.000000134
Further Details:      
 
Domain Number 2 Region: 3485-3732
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.73e-33
Family WD40-repeat 0.003
Further Details:      
 
Domain Number 3 Region: 2958-3061
Classification Level Classification E-value
Superfamily PH domain-like 3.07e-23
Family PreBEACH PH-like domain 0.011
Further Details:      
 
Domain Number 4 Region: 278-456,736-800,848-887
Classification Level Classification E-value
Superfamily ARM repeat 0.0000184
Family GUN4-associated domain 0.074
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000034126
Domain Number - Region: 1424-1451,1480-1623
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0222
Family Clostridium neurotoxins, the second last domain 0.037
Further Details:      
 
Domain Number - Region: 252-270,318-367,399-634,777-861,1056-1141,2239-2302,2354-2400
Classification Level Classification E-value
Superfamily ARM repeat 0.0633
Family MIF4G domain-like 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000034126   Gene: ENSTRUG00000013388   Transcript: ENSTRUT00000034252
Sequence length 3747
Comment pep:known_by_projection scaffold:FUGU4:scaffold_469:66334:92364:1 gene:ENSTRUG00000013388 transcript:ENSTRUT00000034252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGASNTLAREFLTDVHQLCSAVAQRAETREEDEEESHMVALGEYLVRGRGFLLLSTLDS
IIDQELTCREELLTLLLSLLPLVWKIPVREEKAPDFTLPSLLEVFLRRDVKNSPLREGKK
PAADELNSSKRSRFGSGTWKSRQSRRTAQKYSVKDARKSQVSTSDSEENPDCKAAAGHGS
GSGRRTRGSTVRVSCQHHRPEPFVATSTTVPADTMSAPHLHPRAPGPLMMDVETLTDPAA
VSIFNRMENSPFDLCHVILSLLEKVCKFDLNLNHNPGLAVSVVPTLTEILAEFGECCAPG
GGSGGGAGIEEVARGWGEEPIALIQRMLLRTILHLMSVDISQSETLSDSLRRSLTDLLRA
TLRIRSCLDRQTNPFAPRLKKTLQEVQEEFSFSRHRHRALLLPELLDGVLQVLLSCLQAS
TSNPFFFSQALELIHEFVQHCGLDLFETTVLRLEGLSRATDTEIVGEATERLRGLIAGVF
KITSAIKKAKSEQLHQSVCARRRHRRCEYSHFLHHHRDLSGLPVSAFKQAARRNPFEEDG
DGKGESEGYAARYPERCCCLAACAHQCLRLLQRLSPSGPAVLQVLAGVQAVGICCCMDPR
SVIGPLLHAFQAPALRAYQANVLSVLGRLILEQLGGGQPSEKAKLASCNICTLDSSQLLG
LEETLQQGHTLSVSSTLCYRSQGILPSGGGAEDMLWKWDALEAYQQLVFGEDWQLSQQIA
GHVCHLTLRGNAVVQWQLYTHILNPVLQRGVELAHHAQQLGVSAVCTQVCSYHTRCLPVD
ILLIYLQTLPSLLKSRVIRDLFLSCNGLNQVTELVYLDQTRSLALKVFETLIIGSGLYQM
GGMLQELQSTDAEEREAILGLAEELRYQGAGEGPQSLSKFYEGLKEKYPCYKNRSQAETH
LHVINLFLCVAFLCVSKEGDSDRDSANESEDTSGYDSTASEPLGGRLPYLSPDSIVLPSK
EQTRRAADVWTVCQWIYLSSPLFQRQFFKLGGLDVCLRLMTMVIQKLSCKSKDGKPKKRR
EGKPKCSPESTGLAVEPEQEETCSESAGLADTKSKDPERKLEEEWQLQSIRLLEALLAIC
LHSSNSTFQKTEPELSCQLQSVEETLLEVRDQLSCSGVVNSDLAIPLFDSLLRVALAQAS
SSPDAPEEKPERKPQVLAEGAVQAGDLSEEVDEAQSCGNKPLGEEEGYDADSESNPGDMA
KQEEGRSTQREHVSPCTQITCNFGLPHIMLGVLLFPEICTMQLHLLTTGSPDLEVLNHVF
HSLLGAVQANQRNATLLYNQGGVKTILSGFHDILSQTDPSFTDCQTVLVELLVAMVSQRI
TAEELALLIRLFLEKTPPTDVLLKGIQLIVEANMNLEPLHLLTFPVILGATPGSVSASFR
QNGSTGGKNVSLLWKGMLSPGRGEGDGERRPSHMCFSPWHAAPLHLPLVGQNCWPHMANG
FSVSMWLRVAEQDRDKSKEERNPPAAQPHHGCAQAGPRQVEEGLSHILSMGSKALMFQVW
ADFSTGSLTFRICIDPNDEVKAGLLAQAESGVKLLKPGQWQHMGLTYTQQPEGKKNTLGR
VVVWVCGIRKCEVSLVYSLPRKSSLSSDSNKTFCMLGHCMQTSGELMKEGKCWSMGTVLL
FNGSRIGTEEALYLYTSGPDLTSIMPCKYGKPSGIFTKFVTEDSLRSEHVRDLFLKNKDL
DTAALVESLAVVYAPSNPRVYTIYEPVIRLKGQAKTVVTQRPFSSKEVQSLSLEPSALRA
LLPTETQGLQSVLHKIGGLGTFVFLYARTVELSDCERTQALALQVLLSLAKFNQHRIQEM
DCYHGYSMIHQVLIKSKCIVGFHVLKTLLDGCCSRPVLVLGDDGQFRLDTDSVAVVQDVR
LLSDVLLDWKIWAKAECRVWETLLTALEVLIRVHHPHQVFNIRQFLKAEIVHRFLLTCQV
LQEHRDEHLTAIPQEVCLSFVRIIQEVLGSPPDLELLKLISSFLLAVHPPTNTYVCHTPA
SFYFSLHTDGKLHQEKVQSIMYLRHPSSGGKSPCSSVASLSPTVFTDAPHEGHPHAPSPN
PGGEDQLLRPPSLAPSPYASPLPTPRLGHVNSNEAGEGDGSSLATLGSTETLKKGGDELL
LSSCESAKTICSKDAGGEASLRTPSISVEEDRDDATEVDSLADGSVGVAASEDRFDWATE
ETPPRPDSLKGIRSFQRSPSNLASLGLAFPAPNGSLAISRWPSAAERGSVPEDWESYTYS
PGYERARSKTSESNDSTEDCLVLICCGLYDLLRGILLLLPDLMLEEVMDKLIQPEALIVL
VNHPSPLIQQGVMKLLDAYFSRALKEQKEKFLKTHGFSLLANQLYTHKGNQGLLECFLEM
LFGRPVSLEEDLDLEEMDTISPFRKRCIIPVLGLIENSLYENALAHNLLCMLLQLLNACP
KLADILLDHGLLYVLFNTLSTLNGMEMGIPLNDYKLLVCDIQQLLVAVTIHSCSSSGSQY
FRIIEDLITLLGFMQTSKIRRTQEMAVALQFRVLQSAIEFIKTTANQDPQKLSSSVNAPS
SPHPAVDQKRRSIAGRFSLAQTDSLLMRMRSVASDELHQMMQRRMSQENPIRASETEFVQ
RLQKLVVLAVNRLLYHDVSQDFFDLLNIPDSPDQQLFPAEPHESGSASVPHSPGPFNLPP
ASKKSFQKAVLKLMMDGIKTSLGSTGRGGAPHHQWRRILWSCRDTFRVQIGRLLVHTLSP
ALPLTDRKEALEFVFDARHLDILKESLSPSLEHGPKLSLYLHEMLHDHKDSLTKDDQNAV
GVFMTSLKLCGHRCIPPNAAHKQDLLKAIKEEKLKYETEERTSRAAWEKKLVNTQRNLIS
RLDGKSKDISKIAADITQNVSLQQGMERKKVIQHIRGLYKIDLSASRHWQELVQQLTHDR
AVWNDSSSYPTSWQLDATEGPNRERRRLQRCYLTIPNKYLLRDRRKAEDPAKAALSFLFE
DKTHSSFSSTVKDKATSESIRFTRRCVSVAPSRETSGELLLGKSGMYFVEDNAADAHDSQ
SLHGETEAPSFSWTYEEIKEVHKRWWQLRDNAVEIFLTNGRTLLLAFDNTKFRDDVFHNI
LTSDLPNLLEHGNITALTHLWSSGQISNFEYLTHLNKHAGRSFNDLMQYPVFPFILRDYT
SETLDLQDASIYRNLSKPIAVQSKEKEDRYVDNYRYLEEEYKKGVREDDPMPPVQPYHYG
SHYSNSGTVLHFLVRMPPFTKMFLAYQDQSFDIPDRTFHSMNTTWRLSSYESMTDVKELI
PEFFYLPEFLVNREGFDFGVRQNGERVNHVNLPPWARNDPRLFILIHRQALESDQVSQTL
CQWIDLVFGLKQKGKAAVQAINVFHPATYFGMDVSAVEDPVQRRALETMIKTYGQTPRQL
FSGSHVSRAASRVLMEGELPAAMGLLVQLAFRESREQTKEITCPSPLPWIKGLKWGEYVG
SPSTPDPVVCFSQPHGERFGSLLALPTRAICGLSRKFCLMMIYSKEQGVRSMHSTDIQWS
AILSWGYADNILRLKSKQSEPPINFIQCSQLHQVTSCAWVPDGCQLFTGSECGVITAYSN
RFTNTTPSEMEVESQVHLYGHTAQVTGLFVCKPYSVLVSVSNDGTCILWDLNRLCYVQSL
AGHKSPVTAVSASETSGDIATVCDSVGGGSDLRLWTVNGDLIGHVHCREIICSVAFSNQP
EGMSVNVIAGGLENGVVRLWSTWDLKPVREITFPKSSRPIISLTYSCDGHHLYTANSEGT
VMAWCRRDQQRMKLPMFYSFLSSYAAG
Download sequence
Identical sequences H2UB08
ENSTRUP00000034126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]