SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000034366 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000034366
Domain Number 1 Region: 138-456
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.96e-94
Family Protein kinases, catalytic subunit 0.0000000000721
Further Details:      
 
Domain Number 2 Region: 4-113
Classification Level Classification E-value
Superfamily PH domain-like 1.76e-23
Family Pleckstrin-homology domain (PH domain) 0.00000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000034366   Gene: ENSTRUG00000013476   Transcript: ENSTRUT00000034492
Sequence length 475
Comment pep:known_by_projection scaffold:FUGU4:scaffold_23:1318644:1340703:-1 gene:ENSTRUG00000013476 transcript:ENSTRUT00000034492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTNVVIVKEGWLHKRGEYIKTWRPRYFLLKTDGTFIGYKERPQDVDQLETPLNNFSVAQC
QLMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTKAIQAVAEGLQKQEEEMMDS
SPDPMDMEVCLTKIRHKVTMHDFEYLKLLGKGTFGKVILVKEKATGHYYAMKILKKEVIV
AKDEVAHTLTENRVLQNSKHPFLTGLKYSFQTHDRLCFVMEYANGGELFFHLSRDRVFSE
ERARFYGAEIVSALDYLHAERNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMK
TFCGTPEYLAPENKVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMED
IRFPRTLGPEARSLLSGLLKKDPMQRLGGGPDDAKEIMQHKFFAGIEWKDVYEKKLVPPF
KPQVTSETDTRYFDEEFTAQTITITPPGQDDSMESFDSERRPHFPQFSYSASGTA
Download sequence
Identical sequences H2UBP8
ENSTRUP00000034366 ENSTRUP00000034366 31033.ENSTRUP00000034366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]