SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000034411 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000034411
Domain Number 1 Region: 364-543
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.89e-56
Family SPRY domain 0.00035
Further Details:      
 
Domain Number 2 Region: 1-70
Classification Level Classification E-value
Superfamily RING/U-box 1.28e-20
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 3 Region: 134-196
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000229
Family B-box zinc-binding domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000034411
Domain Number - Region: 179-250
Classification Level Classification E-value
Superfamily HRDC-like 0.0131
Family RNA polymerase II subunit RBP4 (RpoF) 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000034411   Gene: ENSTRUG00000013492   Transcript: ENSTRUT00000034537
Sequence length 544
Comment pep:novel scaffold:FUGU4:scaffold_80:891653:899116:-1 gene:ENSTRUG00000013492 transcript:ENSTRUT00000034537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSCSICLDVLKNPVTIPCGHSYCSDCIENYWDQDQYLAVFSCPQCRQNFTPRPALARNTM
LAEVVEKFRKTELEEAATTQSQNFVEAVDVECDVCTVRRSKAVRSCLVCLASYCELHVQP
HYESAAFKKHKLVSASKILQQTICSQHNKLLEAYCRTDGLCICYLCLTDEHKGHDTVMAN
VEIREKQRQISEMQQNAQMKIEHREKEAQELKQAMSYLTRSARAAAENSDTIFSELIQSI
ELKRFEVRELIKAQEKSSVRPAELLLQDIQKEIAELKTCVAELSKLSEMEDDIQFLQSCQ
TLQAPSVLSTLPGVAVEPHMTFDPVMTALSDFKGLLQEVCQEGFVSIYKRGNLLESYNLD
PKTRADFLQYYSDITLDPNTANPYLSFSDGRREVTTRFEAQPYPDHPARFTSWAQVLCCA
GMAGRCYWEVEWSGTGGVSIGICYKNMSRCGGGSDSKLGHNSKSWSLDCSYTSCLFQHNK
ESVAVTTPCSSRVGVYLDFRAGTLSFYNVSSATVLLHKVQTTFSQPVYPGFWVGLGSSLK
LCCL
Download sequence
Identical sequences H2UBU3
ENSTRUP00000034411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]