SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000034413 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000034413
Domain Number 1 Region: 369-544
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-54
Family SPRY domain 0.00035
Further Details:      
 
Domain Number 2 Region: 2-73
Classification Level Classification E-value
Superfamily RING/U-box 1.37e-21
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 3 Region: 137-199
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000229
Family B-box zinc-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000034413   Gene: ENSTRUG00000013492   Transcript: ENSTRUT00000034539
Sequence length 545
Comment pep:novel scaffold:FUGU4:scaffold_80:891665:899125:-1 gene:ENSTRUG00000013492 transcript:ENSTRUT00000034539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KDHFSCSICLDVLKNPVTIPCGHSYCSDCIENYWDQDQYLAVFSCPQCRQNFTPRPALAR
NTMLAEVVEKFRKTELEEAATTQSQNFVEAVDVECDVCTVRRSKAVRSCLVCLASYCELH
VQPHYESAAFKKHKLVSASKILQQTICSQHNKLLEAYCRTDGLCICYLCLTDEHKGHDTV
MANVEIREKQRQISEMQQNAQMKIEHREKEAQELKQAMSYLTHSAEAAAEESERIFSRLI
RSIEKQSGEVKELIRLQEKAAVGKVEELLEKIQREMAVLKRAEGELLKLSGNEDHVRFLQ
DCKALHFPASAIEMPNTDALPYLMYKSMREAMTDLRLGLGEMLDRELSRISDKGAPNNSI
NAIVSRNVDFLLRDYSDITLDPNTANPYLSFSDGRREVTTRFEAQPYPDHPARFTSWAQV
LCCAGMAGRCYWEVEWSGTGGVSIGICYKNMSRCGGGSDSKLGHNSKSWSLDCSYTSCLF
QHNKESVAVTTPCSSRVGVYLDFRAGTLSFYNVSSATVLLHKVQTTFSQPVYPGFWVGLG
SSLKL
Download sequence
Identical sequences H2UBU5
ENSTRUP00000034413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]