SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000034414 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000034414
Domain Number 1 Region: 375-535
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.82e-51
Family SPRY domain 0.00036
Further Details:      
 
Domain Number 2 Region: 12-84
Classification Level Classification E-value
Superfamily RING/U-box 8.17e-22
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 3 Region: 148-210
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000229
Family B-box zinc-binding domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000034414
Domain Number - Region: 193-264
Classification Level Classification E-value
Superfamily HRDC-like 0.0122
Family RNA polymerase II subunit RBP4 (RpoF) 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000034414   Gene: ENSTRUG00000013492   Transcript: ENSTRUT00000034540
Sequence length 535
Comment pep:novel scaffold:FUGU4:scaffold_80:891695:899158:-1 gene:ENSTRUG00000013492 transcript:ENSTRUT00000034540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVMAQAGVVLDKDHFSCSICLDVLKNPVTIPCGHSYCSDCIENYWDQDQYLAVFSCPQCR
QNFTPRPALARNTMLAEVVEKFRKTELEEAATTQSQNFVEAVDVECDVCTVRRSKAVRSC
LVCLASYCELHVQPHYESAAFKKHKLVSASKILQQTICSQHNKLLEAYCRTDGLCICYLC
LTDEHKGHDTVMANVEIREKQRQISEMQQNAQMKIEHREKEAQELKQAMSYLTRSARAAA
ENSDTIFSELIQSIELKRFEVRELIKAQEKSSVRPAELLLQDIQKEIAELKTCVAELSKL
SEMEDDIQFLQMVPNCPQDPDTSTFKAVALSFAGFFSSPEKAAGSLFEHSAEAAAEESER
IFSRLIRSIEKQSDYSDITLDPNTANPYLSFSDGRREVTTRFEAQPYPDHPARFTSWAQV
LCCAGMAGRCYWEVEWSGTGGVSIGICYKNMSRCGGGSDSKLGHNSKSWSLDCSYTSCLF
QHNKESVAVTTPCSSRVGVYLDFRAGTLSFYNVSSATVLLHKVQTTFSQPVYPGF
Download sequence
Identical sequences H2UBU6
ENSTRUP00000034414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]