SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000034415 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000034415
Domain Number 1 Region: 386-553
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.52e-53
Family SPRY domain 0.00036
Further Details:      
 
Domain Number 2 Region: 10-82
Classification Level Classification E-value
Superfamily RING/U-box 8.39e-22
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 3 Region: 146-208
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000244
Family B-box zinc-binding domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000034415
Domain Number - Region: 191-262
Classification Level Classification E-value
Superfamily HRDC-like 0.0131
Family RNA polymerase II subunit RBP4 (RpoF) 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000034415   Gene: ENSTRUG00000013492   Transcript: ENSTRUT00000034541
Sequence length 553
Comment pep:novel scaffold:FUGU4:scaffold_80:891695:899152:-1 gene:ENSTRUG00000013492 transcript:ENSTRUT00000034541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQAGVVLDKDHFSCSICLDVLKNPVTIPCGHSYCSDCIENYWDQDQYLAVFSCPQCRQN
FTPRPALARNTMLAEVVEKFRKTELEEAATTQSQNFVEAVDVECDVCTVRRSKAVRSCLV
CLASYCELHVQPHYESAAFKKHKLVSASKILQQTICSQHNKLLEAYCRTDGLCICYLCLT
DEHKGHDTVMANVEIREKQRQISEMQQNAQMKIEHREKEAQELKQAMSYLTRSARAAAEN
SDTIFSELIQSIELKRFEVRELIKAQEKSSVRPAELLLQDIQKEIAELKTCVAELSKLSE
MEDDIQFLQSCQTLQAPSVLSTLPGVAVEPHMTFDPVMTALSDFKGLLQEVCQEGFVSIY
KRELRIIFLTDSDKHKLLMPKYPKTRADFLQYYSDITLDPNTANPYLSFSDGRREVTTRF
EAQPYPDHPARFTSWAQVLCCAGMAGRCYWEVEWSGTGGVSIGICYKNMSRCGGGSDSKL
GHNSKSWSLDCSYTSCLFQHNKESVAVTTPCSSRVGVYLDFRAGTLSFYNVSSATVLLHK
VQTTFSQPVYPGF
Download sequence
Identical sequences H2UBU7
ENSTRUP00000034415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]