SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000034641 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000034641
Domain Number 1 Region: 1-364
Classification Level Classification E-value
Superfamily Sema domain 2.35e-100
Family Sema domain 0.00000155
Further Details:      
 
Domain Number 2 Region: 366-399
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000523
Family Plexin repeat 0.0028
Further Details:      
 
Domain Number 3 Region: 418-475
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000223
Family I set domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000034641   Gene: ENSTRUG00000013566   Transcript: ENSTRUT00000034767
Sequence length 529
Comment pep:known_by_projection scaffold:FUGU4:scaffold_2:1028021:1033795:1 gene:ENSTRUG00000013566 transcript:ENSTRUT00000034767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSNVITVIEKFQDSLFVCGTNGNKPRCWKLYSSVNNQPPEVMESYEGIGISPFIPTQNSI
SLTVEGDLYSAAPLDADGSFLQFRRKAGGRTSVWMYENWVTDPTFISASWVQRKDDPDNE
KIYVFFREKNADTNPEADPWVSRVARVCKVDEGGSKRFFQNMWTTFLKARLVCGFPDESL
YFTRLQDIHVVHADEWHDTRVYALFTSSWNSTAVCVYSIDMIEDVFETSTFKGYSNDIPT
PRPGTCVRNSKSLPLATINLVKNHPEMTDWVHPVHRTAPFYISNNNYIKIAVDRVQAAAG
RMFYVLLLSTDSGKIHKVLEAGSKPFIISETQLSSRSPVQSIKLDSIKKKLVVGFSEKIS
AVDLQRCQDYNRSCQSCVLARDPYCSWTHSGCAPLQQLNRTRREAISAALAGTGTTHSVP
LGVPFYLSCPIDSYHAVYTWEHGGQRSPCLQMQSQCLHLIPAMTQENYGNYKCVSEEKGF
TNELKSYLLEEQIKLNTEILTAKWNDASAVVSQFWLSLGLSVASGVMGM
Download sequence
Identical sequences H2UCH2
ENSTRUP00000034641 31033.ENSTRUP00000034641 ENSTRUP00000034641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]