SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000034886 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000034886
Domain Number 1 Region: 179-390
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.19e-52
Family DBL homology domain (DH-domain) 0.000000131
Further Details:      
 
Domain Number 2 Region: 2-233
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.62e-39
Family Calponin-homology domain, CH-domain 0.0034
Further Details:      
 
Domain Number 3 Region: 377-543
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-28
Family Pleckstrin-homology domain (PH domain) 0.0092
Further Details:      
 
Domain Number 4 Region: 629-741
Classification Level Classification E-value
Superfamily SH2 domain 8.3e-24
Family SH2 domain 0.00065
Further Details:      
 
Domain Number 5 Region: 776-835
Classification Level Classification E-value
Superfamily SH3-domain 6.17e-21
Family SH3-domain 0.0008
Further Details:      
 
Domain Number 6 Region: 583-658
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000454
Family SH3-domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000034886   Gene: ENSTRUG00000013652   Transcript: ENSTRUT00000035014
Sequence length 837
Comment pep:known_by_projection scaffold:FUGU4:scaffold_40:1006895:1015383:-1 gene:ENSTRUG00000013652 transcript:ENSTRUT00000035014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELWRQCAAWLIECRVLPDNHRVTWENAQVCDLAQALRDGVLLCQLLNNLLPQAVNLREI
NLRPQMSQFLCLKNIRTFLGVCLAKFYLKKSDLFEAFDLFDVRDFGKVIDTLSILSHSHV
ATQRGLQSFPIEGSNLDEEIYSGLSDYIDETLDEDDDLYDFVEDEEDKGDEIYEDLMKIE
EPPQQKCGVDKRECCLQEIRQTEEKYSETLESVMQHFRKPLERFLQPQDIESIFSNIEDL
AKIHRSLLGEVRASILNYGARNLYQVFLDYKERLLLYGSYCSQVEMATKHLDKLSSQRED
IRMKLEECSNRANSGRFSLRDLLMVPMQRVLKYHLLLQELVKHTTDAKDKENLRLALDAM
RDLAQCVNEVKRDNEIIRQITTFQLSIENMTHSLALYGRPKIDGELKICTPEKKSKHDRF
AFLFDKAMFVCKKKSGETFELKEIIELQSYQIRDEPSGEKDNKKPEQWSHVFLLLDVYGG
TGYDLYFKTRELKKKWLEQFEMALSNLCPENSTANRHDFQMHCFEGTASCKACSMLLRGI
FFQGYRCTRCKMAAHKECLGRVDVCGRNSESIGTIKKRSSGYVNPGFPKMEVCQDYYGLP
PPPVGFGQPLHLSKGDIVELTRADADLSWWEGRNLGVGHIGWFPCQRVQPYVPRPTPDLS
DFPWFAGNLDRAAAKNLLTPRSDGTFLVRQKDGGEFAISIKFNMDIRHIKITTNDGLFRI
NDKKAFRGLLELIQFYRQNSLKEYFKEVDTALCTPFKQSEKIEGEEKLTILNSGGSVKGL
SVARARYDYSARDRSELSLQEGDTIKIISKKGHSGWWKGEVYGRVGLFPANYVDEDF
Download sequence
Identical sequences H2UD67
ENSTRUP00000034886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]