SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000035016 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000035016
Domain Number 1 Region: 284-524
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.31e-65
Family Nuclear receptor ligand-binding domain 0.0000000299
Further Details:      
 
Domain Number 2 Region: 169-249
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.63e-27
Family Nuclear receptor 0.0000287
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000035016   Gene: ENSTRUG00000013709   Transcript: ENSTRUT00000035144
Sequence length 573
Comment pep:known_by_projection scaffold:FUGU4:scaffold_392:128610:133971:1 gene:ENSTRUG00000013709 transcript:ENSTRUT00000035144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVASTPHKNQPLLQLQKVDSSRLGARVVSPILGASLETSQPICIPSPYTDLNHDFSGIP
FYGPTIFGYASPAISDRASIHRSMSPSLFWPPHGHVGPHMPHHHSQPRPQHGQPIQSPWA
ELSPLDRCGGTSWQLAKLVSTKVIGKSTRRRSQESEEAVVSSGGKADLHYCAVCHDYASG
YHYGVWSCEGCKAFFKRSIQRQNDYICPATNQCTIDKNRRKSCQSCRLRKCYEVGMTKCG
MRKERRSSRNPQMRRGTRQASQSRPTRPSELSGPTVGPFDALHPSQLTSEQLINTILEAE
PPEIYLMKDMKGPVTEASIMMSLTNLADKELVHMITWAKKIPGFVELSLLDQVHLLECCW
LEVLMIGLMWRSVDHPGKLIFSPDLSLSREEGSCVQGFSEIFDMLIAATSRVRELKLQRE
EYVCLKAMILLNSNMCLSPSEGSEELQSRNKLLRLLDTVTDALVWAIAKTGLTFRDQYTR
LAHLLMLLSHIRHLSNKGMDHLHCMKMKNMVPLYDLLLEMLDAHIMHSSRLSHRPPQQDL
AEPTGSPTKHHSHAGGSSSAWSPSSSREGGEAR
Download sequence
Identical sequences H2UDJ7
ENSTRUP00000035016 ENSTRUP00000035016 31033.ENSTRUP00000035016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]