SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000035210 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000035210
Domain Number 1 Region: 377-485
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 1.96e-27
Family FAD-dependent thiol oxidase 0.0034
Further Details:      
 
Domain Number 2 Region: 7-94
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.46e-17
Family PDI-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000035210   Gene: ENSTRUG00000013781   Transcript: ENSTRUT00000035338
Sequence length 630
Comment pep:known_by_projection scaffold:FUGU4:scaffold_114:871746:882926:1 gene:ENSTRUG00000013781 transcript:ENSTRUT00000035338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLYTKEDPLVILSSGSLKSSVTNSSSAWLLQFFSSWCGHCVQYSSTWKILAEDVKDWQTV
IVVSVLDCAQEENYDICREFGVQLYPTIKYFHAHSPESDRGTIFRASGADRQVQVMRHLM
VDILQNHTKLERPDHCPPLETYSSEDLLPLLGQRSEYYTAIIVEEPESYIGREVILDLLM
FSGVEVKRALSSDRLLMDALKITTFPSLYLLHPNSTHTELHIEKKQRFFFSSLLKMLPGV
QRKPRGFGRTSATGLLEALSGKATSVSWRTFNSVKVYTADLESALHYLLRVELATHDYLE
GEELNIFKDFVTVVAKLYPVGGSVVKLMKTLSNWLSSIPLQRLSYQKVLDLVDNKMRIAG
MFLGAELRWVGCQGSRAGLRGYPCSLWTLFHILTVQHDAMPTALENTGLEEEAAPVLQVM
RRYMRTFFGCGECGRHFEQAAASSMDQVENKEDQILWLWDQHNRVNARLAGTLSDDPQFP
KALWPGPTLCASCHEEKNGVHIWNRNKVLVFLRQHYGASNLSPKYSIRPPEPPSEPAQFH
PFQKEHQEDNKELNLKFKEHPESQARHQIIKQDAGGPEGGVWVLGLGFNSIDMSLCVVLY
VCSCLVLMFLFFFFKVKSKRWKHRQSHLQV
Download sequence
Identical sequences H2UE41
ENSTRUP00000035210 31033.ENSTRUP00000035210 ENSTRUP00000035210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]