SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000035420 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000035420
Domain Number 1 Region: 2024-2326
Classification Level Classification E-value
Superfamily BEACH domain 1.29e-122
Family BEACH domain 0.0000000113
Further Details:      
 
Domain Number 2 Region: 2436-2720
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.46e-32
Family WD40-repeat 0.001
Further Details:      
 
Domain Number 3 Region: 1910-2000
Classification Level Classification E-value
Superfamily PH domain-like 3.61e-21
Family PreBEACH PH-like domain 0.0053
Further Details:      
 
Domain Number 4 Region: 476-564,987-1081,1108-1221,1248-1318,1484-1611
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000102
Family Armadillo repeat 0.073
Further Details:      
 
Domain Number 5 Region: 602-754
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000538
Family Laminin G-like module 0.06
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000035420
Domain Number - Region: 267-361,397-460,489-548
Classification Level Classification E-value
Superfamily ARM repeat 0.000409
Family Armadillo repeat 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000035420   Gene: ENSTRUG00000013855   Transcript: ENSTRUT00000035548
Sequence length 2734
Comment pep:known_by_projection scaffold:FUGU4:scaffold_48:794929:820165:-1 gene:ENSTRUG00000013855 transcript:ENSTRUT00000035548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKGGGMASKERLYELWMLYYTKKDVSYLQQWLEAFVASFERLIDVQSLEPRKLEDCSADV
PLLPREVLVLLSTKLWDSAVHLSVGEHSGSTPHPLLLIKFFIIVCRNMENIDTDKTPGFV
FETIKLLSFCLDQLKLDRGDQQSLQQVVQYGLVLCESLFDPYQTWRRRLAGEEVSLLERN
KYKFSPLGLPEELPALFHECLQESQKIPELLTLRLVHLQGAVISGGKKNGLLSITPDSVE
DLFLVLRAWCCQVSAEPKATRLPRLTLQCLTAVIHLLHSSSPAERQVEIKAILDSYFQLL
NWNRPLSSECQARQSWEDSLISLQSQMLTAVPEILQCSDRPVLQAVFLNNNCFEHILRLI
QNSKLFQSNRRKPERDIMCDLTTCLLTEVEVDQVWEKGAESITIHALGVLTAIMSNSPSA
KEVFKERIGYSQLFDVLKSQGQPTKRLLQELMNMAVEGEHAHVHHLGISNDQPLLLLLQW
LPDLSGQRDLQLLVAQWLAAVCGGSLSCRTVAVEAGMVGALLQVLSEPQSLDRQCADALL
GLLQELGSLSLRPEEMKGLLRLLRVDQENGAAVGKMHPYCARIIRVLSAMAAREGKDSAL
QYFDLTPPMAGIMVPTVQRWPGSGFAFHAWLCLNTELTGTHHDMGKGARRKQLYSFFTAS
GTGMEAFFTMEGVLVVAVCTKKEYMAVALPEYPLADSCWHSVAIVHIPGRRPFGQNLVTI
YIDGEQRMTAQLHFPSLSEPFTSCCIGSAGHRTTTTTSPNLPTTSHSNPSSPEFTFPIHG
PSLIRSQSFPASFAGGRWNSIGNTSVHVIPAGLQDSEWGTPTSLDGLLGTVFICHKPLQA
AQAKALHAAGANHVSLFKADGELSDLNSRLLLYYTPEAFKSQICHDLSPNHQYDGRLTGH
RVVNWDIKDVVNVVGGLGVLLPLLEQVCEAEPVCNGSQEISDLLGPELTSSRGPAAMLLP
LKKSSESRLERNSIAAFLLMVKNLICQHPVNQESLLHCHGPSIVGALLSKVSGSMMDMNV
LMACQLLLEQVFNDGNSPLLQQLYQHLLFDFRIWTKSHFAVCLAHLQYLSSVINKAKQRM
KRKYGVQYVLDTIRTYYSVEKDGSPLSDEKQTIQTSLFSLLKDFLKSPTQEELHSVLSYI
LTVGEEGQMVRALDVLYELLKISPRLEQVQTVLLEWGVEQLYGVLLNPSFGDEVRERVFR
VLYKILKSERVSECNKQRIKLKDFGYLGPVCFLEDLTVTMTTVRCLYEQVLATDFSPNFR
DLLAVVSLSHRADLGVRLDICRKLFHLIHDNKDYVKQIAKQAGWQDVLTKLYVKESYASH
AASIVDSSTHSSFDPKYRPSLRREKSLIIEDADVFSLDNTSFRPDEEGRDYHPLSPFDSS
PFDMELGSMMDTGTHTPAGSLTNTPSPLEQSKPFPPLRARKSSSLSNVLDDNSYGKDPSG
DTISNTSNPQQTPEEELYNTLTNIIFSVLWSRSGVEGVEDVVWRERGQVFSVLTKLGSSC
QLVRPPDDIKRSLLEMMLDSSLSDLRVAQGVAPSLVRLLRLLQDFLFAEGTDNHSLWSEK
IFEGVMNLLDKLKAWHSTPGSPGNAELKEMAQIGLRIITGYIKQQRSPVSEMAYLKLHSL
LQTVLCLSWEEVCFLLGQLGAHLWPGGVMIDVEGERSETFPHLVPIVRTLLDQHADPITL
NKLLPNLPITNGSTTFAQDLKAFCRTVEWQGFYQQEVRPTMEQYELDTFGRCHDIMSNFW
NSCFDDLMSTAFRRDKDRSDSKSKFQEVVLDPYLRRVKIENSRYLSWQKQISSQQGVVWR
HWKALCRLLTSERGAWANRVQSEVNWKLSSAETYSKMRLKLVPNYNYDPHSDASAQRDNM
GADSPRSSEPLPLAVAKEAKVSDMEDDQLGEEDFSFLEDKVEGEEESQKEKLVLSEECEL
ITIVAVVPGRLEVTTHHIYFYDISSDKEETEEGIGYDFKRPLSQLREVHLRRYNLRRSAL
ELFFIDQAHYFINFRKKVTFPFSLNLIKSFQERNKVYSRILGLRPPNLFYFGSRSPQELL
KASGLTQKWVNREISNFEYLMQLNTIAGRTYNDLSQYPVFPWVLCDYASPVLDLDDPAVF
RDLSKPIGVVNPRHAQNVREKYESFEDPTGTIDKFHYGTHYSNAAGVMHYMIRMEPFTTL
HIQLQSGRFDCADRQFHSVAAAWQARMESPADVKELIPEFFYFPEFLENLNGFDLGRLQI
SQDHVADVLLPRWAASREDFIRMHMKALESEYVSSHLHEWIDLIFGYKQRGEEAVKALNV
FYYCTYEGAVDLDAIANETERKALEGIISNFGQTPCQLLKEPHPSRMSAENAVRRQARLD
TVPLNIFEQLTKLRPFVEVVSDGFPLIQAVVPKNQTRSFIIQGSDILVTVSSNGLIGTHS
WLPYDKNIANYFMFTKDPTMSNPKMQRFLNGPFSTGVEMSARVLVVSNDGRLLFSGGHWD
CSLRVTQLGKGKLVGRICRHIDVVTCLALDLCGIYLISGSRDTSCIVWKVLQQGGFSSGL
SPRPVQVLCGHDQEVTCVAISTELDMAVSGSKDGTVIVHTIRRGQFLRSLRPPGKSSVPA
QISELQVGMEGHIVVQTSLEGCSRRKGQYSVHVYSVNGHLLSSFTTEEQVTALHLVSEHV
ILGTAQGSLHIRDLYSLDAPVAPLALKVPVRSVSVTKECSHILVGLEDGKLIVVGAGKPE
EVRSGQFSRRLWGSTRRISQVSSGETEYNPTENA
Download sequence
Identical sequences H2UEQ1
ENSTRUP00000035420 ENSTRUP00000035420 31033.ENSTRUP00000035420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]