SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000035950 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000035950
Domain Number 1 Region: 57-196
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000384
Family Phosphotyrosine-binding domain (PTB) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000035950   Gene: ENSTRUG00000014054   Transcript: ENSTRUT00000036080
Sequence length 200
Comment pep:known_by_projection scaffold:FUGU4:scaffold_88:826623:827609:1 gene:ENSTRUG00000014054 transcript:ENSTRUT00000036080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRKVKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGQCNNSSEAC
AEFRVRYVGAIEKLEFNMSKTLQEPLDLIGYIDAAQQDGKLPFVPGDREMILGVSKYGVK
VASLDQCDVLHRHPLYLIVRMLCYDDGLGAGKNLLALKTTDAQQEGCSIWVYQCSSSEQA
QSICKVLSASFDCALSLDKS
Download sequence
Identical sequences H2UG79
ENSTRUP00000035950 31033.ENSTRUP00000035950 ENSTRUP00000035950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]