SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000036116 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000036116
Domain Number 1 Region: 32-127
Classification Level Classification E-value
Superfamily Chaperone J-domain 4.97e-29
Family Chaperone J-domain 0.00021
Further Details:      
 
Domain Number 2 Region: 129-176
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000713
Family PDI-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000036116   Gene: ENSTRUG00000014113   Transcript: ENSTRUT00000036247
Sequence length 186
Comment pep:known_by_projection scaffold:FUGU4:scaffold_81:1048455:1050758:1 gene:ENSTRUG00000014113 transcript:ENSTRUT00000036247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RHVWIKKHCFITEINGLMLALMILVVLLNAVWAESQDYYELLGVSKEANTREIRQAFKKL
ALTMHPDKNPNDPEAHDRFLKVNRAYEVLKDEDLRKKYDKYGEKGFDDHKQGGQYESWNY
YRYDFGIYDDDLEIITLDRGDFEAAVNSGEVWFINFYSPRCSHCHQLAPTVMTLKNNATH
KALYHI
Download sequence
Identical sequences H2UGP5
ENSTRUP00000036116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]