SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000036117 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000036117
Domain Number 1 Region: 449-555
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.2e-28
Family PDI-like 0.01
Further Details:      
 
Domain Number 2 Region: 554-667
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.98e-27
Family PDI-like 0.021
Further Details:      
 
Domain Number 3 Region: 83-231
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.04e-26
Family PDI-like 0.025
Further Details:      
 
Domain Number 4 Region: 24-104
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.94e-25
Family Chaperone J-domain 0.00018
Further Details:      
 
Domain Number 5 Region: 669-771
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.53e-24
Family PDI-like 0.03
Further Details:      
 
Domain Number 6 Region: 351-444
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000612
Family PDI-like 0.02
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000036117
Domain Number - Region: 234-349
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000131
Family PDI-like 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000036117   Gene: ENSTRUG00000014113   Transcript: ENSTRUT00000036248
Sequence length 792
Comment pep:known_by_projection scaffold:FUGU4:scaffold_81:1049191:1056169:1 gene:ENSTRUG00000014113 transcript:ENSTRUT00000036248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHRMVCGVQQQCPSGLMLALMILVVLLNAVWAESQDYYELLGVSKEANTREIRQAFKKL
ALTMHPDKNPNDPEAHDRFLKVNRAYEVLKDEDLRKKYDKYGEKGFDDHKQGGQYESWNY
YRYDFGIYDDDLEIITLDRGDFEAAVNSGEVWFINFYSPRCSHCHQLAPTWRDFAKEMDG
VIRIGAVNCGDNHHLCRSKGINSYPSLFIYRAGQRPEKFSGDRSKDNLVRFSMQFITTTV
TQLWQGNVFKEIENAFSLGLGWLITFCFDTGDCLEPRTRQKLGGMLDGLIKVGWMDCAME
LQLCGSFQVTSAATVFFPPGSSIDQPGSVLWLNTLDSKEIYSQVLDHLPDLQLLTSDNFE
SQLAHHRWLISFTFGDRSPASNEYKKLQAFLRKDHIQVSRVDCTADSKLCQSLYIYKPCI
AVFKGLGIHDFEIHHGKDVLYNIVSFARDSVHAHVTTLRPDNFPADRKEPWLVDFFAPWC
PPCQALLPELRKASIQLVGHMKFGTLDCTIHQGLCSRYNIQAYPTTVIFNGSSVHEYEGH
HSADGILEFIEDLVNPSVVSLDPSSFSEKVKGRATDQAWVVDFYAPWCGPCQALLPEWRR
MARLLLGQVLVGSVDCQRYQSLCQNQNVRAYPEIRLYSSNMKPDHYMSYSGWHRDAHSLR
AWVLRALPSVSVDLTPQSFRSQVLLGQDHWVLDFYAPWCGPCQQFAPEFELLARILKGKV
RAGKIDCQAHQHTCQSAGISSYPTVRFYPYLGTRRHEQSGEYINSRDANTIAYTIGQRLH
HLLPQPQNKPKV
Download sequence
Identical sequences H2UGP6
ENSTRUP00000036117 31033.ENSTRUP00000036117 ENSTRUP00000036117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]