SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000036314 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000036314
Domain Number 1 Region: 393-505
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.57e-30
Family PDI-like 0.0044
Further Details:      
 
Domain Number 2 Region: 276-387
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.15e-30
Family PDI-like 0.011
Further Details:      
 
Domain Number 3 Region: 151-262
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.82e-28
Family PDI-like 0.041
Further Details:      
 
Domain Number 4 Region: 32-142
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000182
Family PDI-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000036314   Gene: ENSTRUG00000014202   Transcript: ENSTRUT00000036445
Sequence length 520
Comment pep:known_by_projection scaffold:FUGU4:scaffold_38:1031325:1053812:1 gene:ENSTRUG00000014202 transcript:ENSTRUT00000036445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSKGGPGATLLEFGLICHSTLETVKVSPLIEKVGDHKDFKKLLRTRTNVLVLYTKSDTSG
DPHLKLLSDVAQTVKGQGTIAWVNCGDSEGRKLCKKVKVDPNSKRGGAELLHYKDGTFHT
EYNRARTFKSMVAFLKDPSGPPLWEENPEAKDVVHIETEKDFRKLLKREERPILVMFYAP
WCGVCKRMQPVFQQAATETKGKYVLAGMNVHPAEFDGLKQEYNVKGYPTFCYFEKGKFLH
HYENYGATAKDIADWMKDPQAPQPKTPEVPWSESGSSVFHLTDDSFDGFLEEHPAVLVMF
YAPWCGHCKKMKPEYDEAAEILNKGVDSPGVLAAVDATVHKGVGDRFKISGFPSLKYFVK
GEEKYTLPQLRSKDKIIEFMHNPQAPPPPEQSWEERPSGVSHLGSEDFREAMKKKKHALV
MFYAPWCPHCKSSIPHFTTAAELFKEDRKIIYAAVDCTKGQNHELCKQEGVEGYPTFNHY
NYGKFVEKYNGERGEDGFTGFMRNLRGRDQEKVGKKKEEL
Download sequence
Identical sequences H2UH93
ENSTRUP00000036314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]