SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000037306 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000037306
Domain Number 1 Region: 5-453
Classification Level Classification E-value
Superfamily Sema domain 1.09e-108
Family Sema domain 0.0000969
Further Details:      
 
Domain Number 2 Region: 1308-1435,1649-1835
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.94e-46
Family p120GAP domain-like 0.014
Further Details:      
 
Domain Number 3 Region: 907-998
Classification Level Classification E-value
Superfamily E set domains 9.8e-17
Family Other IPT/TIG domains 0.073
Further Details:      
 
Domain Number 4 Region: 456-508
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000209
Family Plexin repeat 0.0025
Further Details:      
 
Domain Number 5 Region: 815-876
Classification Level Classification E-value
Superfamily E set domains 0.0000000127
Family Other IPT/TIG domains 0.025
Further Details:      
 
Domain Number 6 Region: 995-1077
Classification Level Classification E-value
Superfamily E set domains 0.0000000672
Family E-set domains of sugar-utilizing enzymes 0.06
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000037306
Domain Number - Region: 1108-1163
Classification Level Classification E-value
Superfamily E set domains 0.028
Family E-set domains of sugar-utilizing enzymes 0.051
Further Details:      
 
Domain Number - Region: 756-791
Classification Level Classification E-value
Superfamily Plexin repeat 0.0549
Family Plexin repeat 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000037306   Gene: ENSTRUG00000014605   Transcript: ENSTRUT00000037441
Sequence length 1865
Comment pep:known_by_projection scaffold:FUGU4:scaffold_54:1251829:1274130:1 gene:ENSTRUG00000014605 transcript:ENSTRUT00000037441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVSGYNHLVLHPDPSMGTVYLGARDRLFQLDASEGLHLKQEESTGPVSDSKDCLPPVTEV
NCPQARKTSNYNKLLLVDPNALELITCGSIHQGTCQKRSLTSIKKIIFSTERPVDTQYVA
ANDPMVSTVGLVVKLNCCEKTVMYVGRGYTASHPPISTRHLSSEPIFSYEETAKLAVTGR
LSEYDHHFVMAFTRHANVYFLFYRRDIKTPLREYRTYAARLCLNDTSYYSYVEVPLVCQS
PSTSSSSYNFLQAAQVPGSPKVVGRGSGREIDNLLGVFSSNPVSANKNPLDSSALCIYPL
DELDQHFDSTRDLCYSKGGHVRGKGEVAYIEYEVKSSCANLPLNTVKAYPCGSDHTPSPM
ASRKPQEAKAVLEIFSHHLTAVAVSVRKGHSIAFLGDTKGTLHKVYLGQDGEVKVYANIT
IQLNSPINKDLLLDHNGTHIYIMTKNTVQKRPVAECGAHLDCWSCLSAIDPYCGWCVLQG
RCGQHWECQQGSVQGQWIWSFNQTQQCLHIHHLSLYNISLGIIVSVKGLPNLGKGEAYSC
FFKDAQTQALFTTSGVICPTPDADSLPPIDHGDEFVVLTLSLRFMNVIVAETEFTFYNCS
LVQQLCQGCVSSRWGCNWCIHQHVCTHKQICSKGVTIFNRNECPSVERVQGSSLLPVSVE
RKITLLAKHLNVFQDKSLDYECVLEIENQSVVVDAAVEPDINQPSVFLIKCQPNQYLYSV
LMEEYTAMIIVRRKNKFRIDSAEDLYVNLFNCSVGRQDCSRCHTADPKYGCVWCNGASAS
GCVYQGSCNGEGNVYMDIKSSNTKCNPDESWQVHLDPLSGPVEGGTVVTISGSNLGQRAE
DVQNSVTVAGIPCSVINSRYEVSSKIVCVTARSGQEKIGQALVMKFVCVQIIVLFVFICL
IFMMLHHQNPVLSSISPRRGPRAGGSSITIRGWGLRTGHSSEVSVLIGEVPCMVLNIQED
KIICVTSGCNRTGDYRVTVHFGGAERHLLGSVYHYTPNPNITMAAPTKSFLSGGRIIRVS
GQNLDVVQEPKMRAKQLKQYESQCCVNSSTLITCPSPAVGSEARRAKVKVLFLMDSLHFD
FTSVGIDNFNYEPNPKLYPLNRNNPTKPYHHKPGSIISVEGENLDLAIYKHEVQALIGEG
VCSVKTLTHNNLYCEPPVQQPSIDANSKQVKMGNLNFSLGRVKYDSQAPSIFPVEAQVGV
GVGASIVALIVLIIVLIYRRKSKQAMRDYKKVQIQLENLETSVRDRCKKEFTDLMTEMMD
MSSDLVGSGIPFLDYRAYIERIFFPSHQESPLRRNLDVPENRRQTVEQGLVQLSNLLNSK
LFLTKFIHTLEVQRTFSPRDRAYVASLLTVALHGKLEYFTDILKTLLNDLVEQYVAKNPK
LMLRRTESVVEKLLTNWMSVCLFTFLQESAGESFYMLFRAIKHQVDKGPVDVVTGKAKYT
LNDNRLLREDVEYRTLTLNVVIPAAATCTGATSQIVPAKVLDCDTITQVKEKLVEQTWKG
TSFSQRPHIDSLQLEWRAGVAGHLILSDEDLTSVVQGSWKRLNTLQHYKVPDGATMALVL
SKHHLHDSHDYMPGEMTSQNGQEMKLFHFVSCCDSLEPIPSETPALDDGEEEGVRLWHLV
KAREESELPKHRKGSVRERGGERAKAIPEIYLTRLLFMKGTLQKFVDDLFTAILSTSRPV
PLAVKYFFDLLDEQALQHGITDPEIIHIWKTNSLPLRFWINILKNPQFIFDVQTSDHVDA
VLSVIAQTFMDSCTIADHKLGRDSPINKLLYARDIPRYKQMVERYYADIRQTIPASDQEM
NSSLAEISRNYTADINCLVALHDLYKYINKYYDQIITTLEEDTTAQKMQLGYRLQQIAAA
VENKV
Download sequence
Identical sequences H2UK35
ENSTRUP00000037306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]