SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000037995 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000037995
Domain Number 1 Region: 748-994
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-61
Family Nuclear receptor ligand-binding domain 0.0000000784
Further Details:      
 
Domain Number 2 Region: 614-691
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.45e-25
Family Nuclear receptor 0.0000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000037995   Gene: ENSTRUG00000014871   Transcript: ENSTRUT00000038131
Sequence length 996
Comment pep:known_by_projection scaffold:FUGU4:scaffold_17:1620523:1665032:-1 gene:ENSTRUG00000014871 transcript:ENSTRUT00000038131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METKRYQSYFDGCDTENRWSQVSGTMDSCSTEESSLTGSDILMDIANVSCSAESPATDRS
TKKQEQPMLQLSQNQPFLLPHFNNTLHGHKQEMDSKELSKTVAESMGLYMNAAREADFAF
SQHGGSASPGKMYSVCGRSLEEAQSGFTKSFKLKPFGFQQCNTTPRECTIGTTVSSASVL
VPSISCSPQTPSSISSPGGSNNMVSSTTSPPMCFGPMCSSVSSPVSQTSCASTLPNIKRR
NSATCSPVESSTVGSPPLTSPLNIMRSPISSPQSMSSVRSPPSCSTTSNIRSSVSSPTGA
NCTSTANNCNTARPSISSPAIGGTVASSSPRNASVGSFPVSSPAGGLGLVQNDTNSPEAA
GLTRDADFKNFEFPKVEMVDGELFSVGVDHMGMVKYIKNEPGSDFRSMCLESSKCNASST
PFITQIKSEPNKNDGCMNQQPYSEPSQSLSLFPSSETTYLSLRNNIDEYSLSGILGTPVS
SLNGNYESDVFSNSVLSKGVKQESPDGSYYQENNSMPTSAIVGVNSSGHSFHYQIGAQGT
MAFTRHDVRDQSNPLLNLISPVTALMESWKSRPGMSQGSLSGRGEGYPGQNCIPESSVSE
STLNSPLRQPTSTAKVCLVCGDEASGCHYGVVTCGSCKVFFKRAVEGQHNYLCAGRNDCI
IDKIRRKNCPACRVRKCFQAGMNLGARKSKKLGKLKAVSDELPGSKDAHTSTGGVSGAYV
PSEKELNASPASALVPHGPGVVTPFLPPSICSVLELIEPEEVYSGYDNTQPDTTDHLLSS
LNRLAGKQMVRMVKWAKVLPGFRGLPIEDQITLIQYSWMCLSSFCLSWRSYKHTNGQMLY
FAPDLIFNEERMRQSAMYDLCLGMRQVSQEFLRLQLTYDEFLSMKVLLLLSTVPKEGLKN
QAAFEEMRLNYVKELRRSVGKATNNSGQTWQRFFQLTKLLDAMHDLVGNLLDFCFYTFRE
SQALKVEFPEMLVEIISDQIPKVESGLTHTIYFHKK
Download sequence
Identical sequences H2UM24
ENSTRUP00000037995 ENSTRUP00000037995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]