SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000038556 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000038556
Domain Number 1 Region: 279-367
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 2.22e-31
Family Small-conductance potassium channel 0.00011
Further Details:      
 
Domain Number 2 Region: 149-319
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.63e-23
Family Voltage-gated potassium channels 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000038556   Gene: ENSTRUG00000015090   Transcript: ENSTRUT00000038695
Sequence length 420
Comment pep:known_by_projection scaffold:FUGU4:scaffold_22:1975120:1987068:1 gene:ENSTRUG00000015090 transcript:ENSTRUT00000038695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YRLRDRKFLLEDKKRLCALALGTAVLGIVLMIVHAETCPFIDKTASHVFNCSISLSTACL
LVLIIAFHYKDIRLFIIDHNQVDWRIAMTSQRVLVITLELIVCVIHPIGTYRELSQHLNS
SSPAPLCISNHRGEAFMDLELLLSMLMFLRLYLVHRTILLHSKVLLSASYRSIGSLNNIN
FTFRFVLKVLMNKYPGRTLLIFIIFFWLTASWMLTLCERKTIEVTGKMDTALWLVAITFL
TVGYGDVSPQTTCGKAVCLFTGVMGVACTAMLVAVVTKTLELNKGEKHVHLFMLDIQISK
RIRHAAANVLRECWLLHRTNLKRGNRGEHRRHQRCLLEAIRVFRHLRLKQRKLRDYVSEM
VDLPKMQMIMCDLSANWNNSYRELEQRILSMEQKLDELSRCFHQTSELLSQVLLRRNPEI
Download sequence
Identical sequences H2UNN5
ENSTRUP00000038556 31033.ENSTRUP00000038556 ENSTRUP00000038556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]