SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000038613 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000038613
Domain Number 1 Region: 222-315
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000723
Family Eukaryotic type KH-domain (KH-domain type I) 0.0038
Further Details:      
 
Domain Number 2 Region: 106-170
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000307
Family Eukaryotic type KH-domain (KH-domain type I) 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000038613   Gene: ENSTRUG00000015115   Transcript: ENSTRUT00000038752
Sequence length 598
Comment pep:known_by_projection scaffold:FUGU4:scaffold_288:127756:134079:-1 gene:ENSTRUG00000015115 transcript:ENSTRUT00000038752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISLNSLWRSPSRRSKWDQPGPGSGGTGEAEAAPTGALDAAAAVAAKINAMLVAKGKLKPS
QIGTPGLPERVISVGKPPVAPKAKDDLVVAEVEINDVPITCRNLLTRGQTQDEISKVSGA
AVSTRGRYMAAEEKTKALPGDRPLYLHVQGQTRQLVDRAVNRIKEIITNGVVKAATASSS
ASSFSPGAASVTVYQQHSPGPPTLPPMSQHKSHFQSGMHYVQDKIFVGLEHAVPGFVVKE
RVEGPGCSYLQHIQAETGAKVFLRGKGSGCLEPASGREAFEPMYIYISHPKAEGLAAAKT
LCENLLQTVHAEYSRFLSQMNTMMPSQQGFAQPPAVNGISPQPPYYPTTGYQSGYPLPVP
PPQPQSVPPPYTVPALVPPAAPLGVPPQYPLPPTQTTAPTPTLPPASFPPTSTVPPKAPP
PANPANPPQKRRFTEEVPDEKNSNLLGYQHGPIHMTNLGAGFSVDSSESAGPTLPSSSGP
LSERDNSRQLMPPPSLPVNSGLLKGLRDLKGTPPPACIPALLEPAVKRLKTGLVAYSGDS
SDEEEDHCSSKPSGPGNPGAAPLPPSSGWIQGYHCPPPQSSRSKTQPPSQTIPFWMAP
Download sequence
Identical sequences H2UNU2
ENSTRUP00000038613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]