SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000039831 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000039831
Domain Number 1 Region: 24-130
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.5e-36
Family PDI-like 0.0014
Further Details:      
 
Domain Number 2 Region: 337-481
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.42e-33
Family PDI-like 0.0002
Further Details:      
 
Domain Number 3 Region: 135-237
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.99e-18
Family PDI-like 0.0093
Further Details:      
 
Domain Number 4 Region: 236-372
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000325
Family PDI-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000039831   Gene: ENSTRUG00000015581   Transcript: ENSTRUT00000039972
Sequence length 495
Comment pep:known_by_projection scaffold:FUGU4:scaffold_104:288773:293455:1 gene:ENSTRUG00000015581 transcript:ENSTRUT00000039972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HQLCICYLCVCLLKSALTGFTQAASDVLEFTDNDFESKIGDHEIILVEFFAPWCGHCKRL
APEYEKAATALKGVVPLAKVDCTSNSNICSKYQVSGYPTLKVFRDGEESGAYDGPRTSDG
IVSYFKKQVGPASVALAGEEELQKFISEKDSSVVGFFADDKSTAQVEFLKAASALRDKYR
FAHTNAEVLLKSQNVGPEGIVLFRPPTLKNKFEDSSVKYSEEKYTSNKIKRFIQDNVLGF
CPHMTEDNKDQLMGKDLLVAYYDVDYERNPKGSNYWRNRVMKVAKTFLDEGKKLNFAVAN
KARFMSVLSEFGLEDHSSAGPLVTIRTAKGEKYAMTEEFLPDGKALERFLLSYFDGSLKP
YLKSEPIPENNDGPVKVVVAENFDSIVNDDSKDVLIEFYAPWCGHCKSLEPKYKELGEKL
ADDPNIVIAKMDATANDVPSPYEVSGFPTLYFSPAGQKRNPKKYEGGREVSDFLSYLKRE
ATNAPVVQEETKKKK
Download sequence
Identical sequences H2USA8
ENSTRUP00000039831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]