SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000039832 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000039832
Domain Number 1 Region: 23-129
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.74e-36
Family PDI-like 0.0014
Further Details:      
 
Domain Number 2 Region: 336-480
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.66e-33
Family PDI-like 0.0002
Further Details:      
 
Domain Number 3 Region: 134-236
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.05e-18
Family PDI-like 0.0093
Further Details:      
 
Domain Number 4 Region: 235-371
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000346
Family PDI-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000039832   Gene: ENSTRUG00000015581   Transcript: ENSTRUT00000039973
Sequence length 500
Comment pep:known_by_projection scaffold:FUGU4:scaffold_104:289127:293476:1 gene:ENSTRUG00000015581 transcript:ENSTRUT00000039973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YRKRATMLKLMLLAALTGFTQAASDVLEFTDNDFESKIGDHEIILVEFFAPWCGHCKRLA
PEYEKAATALKGVVPLAKVDCTSNSNICSKYQVSGYPTLKVFRDGEESGAYDGPRTSDGI
VSYFKKQVGPASVALAGEEELQKFISEKDSSVVGFFADDKSTAQVEFLKAASALRDKYRF
AHTNAEVLLKSQNVGPEGIVLFRPPTLKNKFEDSSVKYSEEKYTSNKIKRFIQDNVLGFC
PHMTEDNKDQLMGKDLLVAYYDVDYERNPKGSNYWRNRVMKVAKTFLDEGKKLNFAVANK
ARFMSVLSEFGLEDHSSAGPLVTIRTAKGEKYAMTEEFLPDGKALERFLLSYFDGSLKPY
LKSEPIPENNDGPVKVVVAENFDSIVNDDSKDVLIEFYAPWCGHCKSLEPKYKELGEKLA
DDPNIVIAKMDATANDVPSPYEVSGFPTLYFSPAGQKRNPKKYEGGREVSDFLSYLKREA
TNAPVVQEETKKKKKKRVEL
Download sequence
Identical sequences H2USA9
31033.ENSTRUP00000039832 ENSTRUP00000039832 ENSTRUP00000039832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]