SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000039835 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000039835
Domain Number 1 Region: 100-149,215-419
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-65
Family Nuclear receptor ligand-binding domain 0.0000294
Further Details:      
 
Domain Number 2 Region: 30-115
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.46e-29
Family Nuclear receptor 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000039835   Gene: ENSTRUG00000015582   Transcript: ENSTRUT00000039976
Sequence length 419
Comment pep:known_by_projection scaffold:FUGU4:scaffold_1:1163699:1166384:1 gene:ENSTRUG00000015582 transcript:ENSTRUT00000039976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPSPLGASGLTTAESESAKSPAPGKALSPALVCKVCGDTSSGKHYGIYACNGCSGFFKRS
VRRRLIYRCQAGTGMCPVDKAHRNQCQACRLKKCLQAGMNKDAVQNERQPRSTAQVRLDS
IDLDPEKEHLATTREPTTSSSSSSSSSSSSGSVLTWPHISSSMSITSSVAPQRCISPQNN
HRFMASLMTAETCAKLEPEDVDENIDVTSNEPERASSEYHMALYPSGSENVYETSARLLF
MSVKWAKNLPVFSNLPFRDQVILLEEAWSELFLLCAIQWSLPLESCPLLSLPDLCPGIQG
KGSYTSLDLRLLQEVFSRFKTLAVDPTEFACLKAIVLFKPETRGLKDPEQVENLQDQSQV
MLGQHIRSHYPSQPARFGKLLLLLPSLRFVNSERIELLFFHRTIGNTPMEKLLCDMFKN
Download sequence
Identical sequences H2USB2
ENSTRUP00000039835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]