SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000040328 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000040328
Domain Number 1 Region: 177-276
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.58e-30
Family Ras-binding domain, RBD 0.0034
Further Details:      
 
Domain Number 2 Region: 310-422
Classification Level Classification E-value
Superfamily PH domain-like 8.49e-18
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000040328   Gene: ENSTRUG00000015785   Transcript: ENSTRUT00000040470
Sequence length 619
Comment pep:known_by_projection scaffold:FUGU4:scaffold_31:1606392:1622562:1 gene:ENSTRUG00000015785 transcript:ENSTRUT00000040470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDKEDQDLDQMFGAWLGELDKLTQSVKSLDDGRPAQPQSQQKAPLRQETNMANFSYRFSI
YNINEALNQGENVDLDALMADLSSIEQELSTINSKPNSSMARLGLTDTKSGTSLRTHFAG
QVNQSWSHNSNAVPHIFVCTYDNSAPDPPPPPPPNLRHKEEQAAKLKAENIRVALEKIKE
AQVKKLVIRVHLSDESSKTMMVDERQTVRQVLDSLLEKSHSGYSADWSLVETLSELQMER
IFEDHENLVENLLNWTRDSQNRLMFTERIEKYAVFKNPQQQNYLLGRKETCEMTERNKEA
LLEECFGGSSVSVPEMEGLLWLKEDGKKSWKKRYFLLRASGIYYVPKGKAKASRDLVCFL
QLDHVNVYLGQDYKSKYKAPTDYCMVLKHPQIQKKSQYIKYLCCDDIRTLQQWINSIRIA
KYGKQLYINFQDAMRKTEAAYDWSSLSSSNAPPPAPPKTFTGGLPPQTAPKPSGPSSLPV
ALSPVSPSEIFGSHVPIKKQTGSPIKKSPSTSSTGSTKRGPPPTPQRASSIRTGSPSEGQ
DEKPKKVESLVSNHQSTEFPSPPPPPPPSQHPQIDSSPDFFPPPPSDSELFPPPPTPPPS
LPSFSSSSSPVPPTSPKSP
Download sequence
Identical sequences H2UTQ4
ENSTRUP00000040328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]