SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000040330 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000040330
Domain Number 1 Region: 7-485
Classification Level Classification E-value
Superfamily Sema domain 1.31e-174
Family Sema domain 0.00000000011
Further Details:      
 
Domain Number 2 Region: 481-532
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000011
Family Plexin repeat 0.0022
Further Details:      
 
Domain Number 3 Region: 547-628
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000565
Family I set domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000040330   Gene: ENSTRUG00000015786   Transcript: ENSTRUT00000040472
Sequence length 718
Comment pep:known_by_projection scaffold:FUGU4:scaffold_60:1379705:1385838:-1 gene:ENSTRUG00000015786 transcript:ENSTRUT00000040472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELTDTKTARPFSFSFNTSDYRILLMDQDQGRLYLGSREYLVALDMHNVNKEPLIIHWPAS
AKRKGECQMTGKGRQGECANFVRLIEPWNRTHLYTCGTGAYQPICTFINRGWRAEDYLFR
LVPGFVESGKGKCSYDPKQENIAVLLNGNLYAGVHIDFMSTDAALFRTMGGRTAIRTEQY
DSRWLNEPVFVQIQQIPDSAERNDDKLYFFFREKSLDSSGGASPSILARVGRVCLNDEGG
QKSLVNRWTTFLKARLICSVIGEDGVETRFDELRDVFIQPTQDERNPLVYAVFTTAGSVF
KGSAVCVYSMADIRNVFNGPFAHKHGHNYQWTEYTGKIPYPRPGTCPGGTFTPGIPSSKS
FSDEAVNFIRSHPLMFHPVYPTHRRPLVVRTGVDYRFTALVVDQVDAVDGRYEVLFLGTD
QGTVQKVIVLPKDPTTMEELTLEEVEVFRSKAAVKTMKISSKRQQLYVSSDAGLTQVSLH
RCSVYGRACSDCCLARDPYCAWDGESCSAFTPSTKRRSRRQDVRHGDPLRQCRGFNAKVE
KRLRETVQFGVEGSGTFLECQPRSPQASVKWLFQGEGKRKLVGRAGGVLKTDHGILLKSL
NQSDAGLYHCLATENNFKHTVARVALRVLDRDIVLALTAQDDEDEEPETHQPGPYPPPSV
ASTPFPPEIRLINQYCQSYWDQMAVGEEPGCRRREEGALMRVLVEVAAEDRFCQWEEG
Download sequence
Identical sequences H2UTQ6
ENSTRUP00000040330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]