SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000041652 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000041652
Domain Number 1 Region: 138-385
Classification Level Classification E-value
Superfamily vWA-like 7.34e-80
Family Integrin A (or I) domain 0.0000000117
Further Details:      
 
Domain Number 2 Region: 380-470
Classification Level Classification E-value
Superfamily Integrin domains 5.75e-29
Family Integrin domains 0.0000278
Further Details:      
 
Domain Number 3 Region: 637-717
Classification Level Classification E-value
Superfamily Integrin beta tail domain 8.5e-21
Family Integrin beta tail domain 0.000053
Further Details:      
 
Domain Number 4 Region: 28-88
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000628
Family Plexin repeat 0.00024
Further Details:      
 
Domain Number 5 Region: 595-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000145
Family Integrin beta EGF-like domains 0.00072
Further Details:      
 
Domain Number 6 Region: 553-591
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000698
Family Integrin beta EGF-like domains 0.011
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000041652
Domain Number - Region: 519-553
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00837
Family Integrin beta EGF-like domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000041652   Gene: ENSTRUG00000016290   Transcript: ENSTRUT00000041796
Sequence length 789
Comment pep:known_by_projection scaffold:FUGU4:scaffold_15:1735203:1742000:1 gene:ENSTRUG00000016290 transcript:ENSTRUT00000041796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAQQISYLKLALFYRFICKFLSVLMVSSNICTSRGVTTCQQCLSVHPSCAWCSREVQTDF
GKGSSLSRCDLKENLVKEGCSERDVEFPFSTLTVQEDASLSDKASGAADDVTQVKPQKIH
MTLRQGDAKRFTVYVKQVEDYPVDLYYLMDLSYSMKDDLSRLRTLGNKLAQTMGSTTSKL
RMGFGAFVDKTMSPYMYTHPPGAVENPCLRIQDKCQAQFGFKNVLSLTEQVARFTEEVEK
QQISRNRDAPEGGFDAVMQAVVCKENIGWRRDASHLLVFTTDAKTHLALDGRVAGLVQPN
DGKCHLDNNNNYNQSTILDYPSLALMTEKMSENNINLVLAVTSYVVSLYKEYSQLIPGTT
VGILSDDSGNVIELIQEAYAKIRSKVQMELLGVPDELHLFFNATCQSGEVVPGLKSCSGL
KIGDTVSFSIEAQLRSCPKEKSRTFTIKPLGFKDSLEVTVDFACSCNCEAEAQANSSLCS
NGNGTYECGICQCHPGRRGPRCECSVEDYSPSDDANCIEKADGPVCSGRGDCLCGQCSCH
ANEFGQVWGKYCQCDDFNCLRFRGELCSNHGKCSCGSCVCDAGWKGENCNCSTRTDTCMS
SIGLLCSGRGNCECGVCQCTQPGAYGATCEKCPTCPDSCTIKKHCVECQHFKRGDYIADN
SCSRICKVIRITVFQDNNAVNCSYKDEDDCVVHFQYYEDRSGKSILFVVNKPECPEGPDI
LVVLLAVAGAILLLGLIGLLIWKLLITIHDRREFAKFEEERAKAKWDTGNNPLYKGATST
FTNIAYRGN
Download sequence
Identical sequences H2UXH3
ENSTRUP00000041652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]