SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000041841 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000041841
Domain Number 1 Region: 963-1176
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.86e-103
Family Thrombospondin C-terminal domain 0.00000000536
Further Details:      
 
Domain Number 2 Region: 32-233
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.24e-40
Family Laminin G-like module 0.0000305
Further Details:      
 
Domain Number 3 Region: 840-961
Classification Level Classification E-value
Superfamily TSP type-3 repeat 4.45e-37
Family TSP type-3 repeat 0.000000563
Further Details:      
 
Domain Number 4 Region: 771-842
Classification Level Classification E-value
Superfamily TSP type-3 repeat 1.23e-16
Family TSP type-3 repeat 0.00026
Further Details:      
 
Domain Number 5 Region: 496-554
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 3.14e-16
Family TSP-1 type 1 repeat 0.000092
Further Details:      
 
Domain Number 6 Region: 442-497
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000183
Family TSP-1 type 1 repeat 0.00012
Further Details:      
 
Domain Number 7 Region: 702-783
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000000288
Family TSP type-3 repeat 0.00014
Further Details:      
 
Domain Number 8 Region: 325-383
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000377
Family VWC domain 0.0023
Further Details:      
 
Domain Number 9 Region: 387-431
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000249
Family TSP-1 type 1 repeat 0.00091
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000041841
Domain Number - Region: 555-608
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0046
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000041841   Gene: ENSTRUG00000016365   Transcript: ENSTRUT00000041985
Sequence length 1178
Comment pep:known_by_projection scaffold:FUGU4:scaffold_24:1757257:1768039:-1 gene:ENSTRUG00000016365 transcript:ENSTRUT00000041985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILQRSLVLLLISFNFLQALPEAVDGEQEDGSSFDLFEISHITRRTLGAKQFRGQNSDAP
AYRFIRFDHLPPVSAPILRQILRQMQNNEGFVFVASIRQDRASRGTLIGFEGPDGQRQFE
IVSNGRANSLDLVYWVDGSQNMVQFEDVDLSDSQWKNITLQVHGENANLYVGCSLLDSFI
LDEPFYEHLQAEGSRMYVAKGSSRESHFRGLLQNVRLLFDTTVEDVLLSRDCEVPKQDHA
NIVSESTEIVDVSPSITTNVIGQKTDEVGPDMCERSCEELSTMFQELKGLRVVVGNLIDG
LQKVTEENTLMKEALGKMKNSKEKNMCWQDGRLFEDKEDWIVDSCTKCTCQESKIVCHQI
TCPPVACASPSFVDGECCPVCLPVDSDDGWSPWSEWTECTVTCGTGTQQRGRSCDATSNP
CTGPSIQTRKCSLVKCDSRVRQDGGWSLWSPWSSCSVTCGEGQITRIRHCNAPVPQLGGK
DCEGNGRETQVCSAEPCPVDGGWGPWSPWATCSVTCGGGVKTRTRECNSPRPQYGGRRCI
GKAADSDSCNKKLCPIDGCLSNPCFAGVECNSSPDGSWDCGPCPAGFRGNGTNCHDMNEC
DMVSDVCYKVSGRQRCVNTDPGFHCLPCPKRYKGNQPFGMGVEAAKKNKQVCEPENPCKD
KTHNCHKHAECIYISHFSDPMYKCECRTGYAGDGFICGEDSDLDGWPNQNLVCGTNATYH
CKKDNCPSLPNSGQEDFDKDGQGDACDKDDDNDGIPDETDNCGLLYNPRQFDFDKDEVGD
RCDNCPYEHNPAQIDTDHNGEGDACAVDIDGDGILNENDNCPYVYNTDQKDTDMDGVGDQ
CDNCPLLHNPDQTDVDNDLVGDQCDNNQDIDEDGHQNNQDNCPYVANSNQADHDQDGKGD
ACDYDDDNDGIPDDRDNCRLTPNADQLDSDGDGRGDACKDDFDNDSIPDILDVCPENNAI
SVTDFRKFQMVHLDPKGTTQIDPNWVVRHQGKELVQTANSDPGIAVGFDEFNAVDFSGTM
YVNTDRDDDYAGFVFGYQSSSRFYVVMWKQITQTYWEDKPSKAFGISGVSLKVVNSSTGT
GEHLRNALWHTGNTPGQVRTLWHDPKNIGWKDYTAYRWHLIHRPKTGFIRVVVYEGKQIM
ADSGPIYDKTFAGGRLGLFVFSQELVFFSDLKYECRVS
Download sequence
Identical sequences H2UY12
ENSTRUP00000041841 31033.ENSTRUP00000041841 ENSTRUP00000041841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]