SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000041963 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000041963
Domain Number 1 Region: 103-129,188-404
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.44e-68
Family Nuclear receptor ligand-binding domain 0.00000000678
Further Details:      
 
Domain Number 2 Region: 49-129
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.89e-30
Family Nuclear receptor 0.000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000041963   Gene: ENSTRUG00000016415   Transcript: ENSTRUT00000042107
Sequence length 444
Comment pep:known scaffold:FUGU4:scaffold_3:1612410:1706560:1 gene:ENSTRUG00000016415 transcript:ENSTRUT00000042107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGSLSPPALPGLPISGYSTPSPATIETQSTSSEEIVPSPPSPPPPPRVYKPCFVCQDKS
SGYHYGVSACEGCKGFFRRSIQKNMVYTCHREKNCIINKVTRNRCQYCRLQKCLEVGMSK
QTAPDDTARPVARWQCQVEMKERRKAGTQYYSSHPHPEHTHTHTHAHTHTHTHTHTHGPV
VVKLQPSLDGWANTLRSVAPRLSHLTLDVDLWDKFSELSTKCIIKTVEFAKQLPGFVTLT
IADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFA
NQLLPLEMDDAETGLLSAICLLCGETDRQDLEQAEKVDILQEPLLEALKIYVRRRRPHKP
HMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLESGATGSRPSG
APPGSCSPSLSPSSAQSSPPTQSP
Download sequence
Identical sequences H2UYD4
ENSTRUP00000041963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]