SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000041964 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000041964
Domain Number 1 Region: 142-424
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.26e-74
Family Nuclear receptor ligand-binding domain 0.00000000225
Further Details:      
 
Domain Number 2 Region: 90-169
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.57e-27
Family Nuclear receptor 0.0000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000041964   Gene: ENSTRUG00000016415   Transcript: ENSTRUT00000042108
Sequence length 463
Comment pep:known scaffold:FUGU4:scaffold_3:1678535:1706560:1 gene:ENSTRUG00000016415 transcript:ENSTRUT00000042108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YILSLRMMYESVDVVGLNPSPNPFLMMEYYNQSRGCLIPEKGLVPGAPHPYSTSIRNQHW
NGSNHSIETQSTSSEEIVPSPPSPPPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRR
SIQKNMVYTCHREKNCIINKVTRNRCQYCRLQKCLEVGMSKESVRNDRNKKKKDEKKPEC
IENYVLSPDTEQMINRVRKAHQETFPSLCQLGKYTTTNSSERRVALDVDLWDKFSELSTK
CIIKTVEFAKQLPGFVTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNR
TQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLLCGETDRQDLEQAEKVDILQ
EPLLEALKIYVRRRRPHKPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQE
MLENSEGLESGATGSRPSGAPPGSCSPSLSPSSAQSSPPTQSP
Download sequence
Identical sequences H2UYD5
ENSTRUP00000041964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]