SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000042719 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000042719
Domain Number 1 Region: 31-227
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.62e-42
Family Laminin G-like module 0.0016
Further Details:      
 
Domain Number 2 Region: 379-531
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000283
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 3 Region: 267-331
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000303
Family VWC domain 0.015
Further Details:      
 
Domain Number 4 Region: 688-759
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000001
Family VWC domain 0.0093
Further Details:      
 
Domain Number 5 Region: 554-614
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000653
Family EGF-type module 0.014
Further Details:      
 
Domain Number 6 Region: 520-560
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000544
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000042719
Domain Number - Region: 332-397
Classification Level Classification E-value
Superfamily FnI-like domain 0.00115
Family VWC domain 0.076
Further Details:      
 
Domain Number - Region: 605-638
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00148
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000042719   Gene: ENSTRUG00000016697   Transcript: ENSTRUT00000042863
Sequence length 813
Comment pep:known_by_projection scaffold:FUGU4:scaffold_2:3112903:3156425:1 gene:ENSTRUG00000016697 transcript:ENSTRUT00000042863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NEFIFIACVLDCCVCNQVLGFGVDPALRISVFDELTLGEGFDGVTQVQGFHSESRAFHFQ
GSSREVVAPTDVSEHMIRKLRGKNEFTVLVTLKQDHLNSGVVLSIHHSEHRFLELESSGQ
RSEVRLHYRTRGQQAHTEVFPYSLADDQWHKVSVAVSASHVILHVDCNRIYERVVEAPYM
DIPEDASFWLGQRNAAHGFFKGVMQDVEILVMPQGYISQCPDLNRTCPTCNDFHGLVQKI
MELQDVLAKTSSKLSRAEEKMNGLEGCYCERTCSVKGVIYREDEGWTDGCRNCTCSNGTV
QCEAISCPPPQCPAGTAPAYVKGACCKECQPLCLFGGRELVEGDQKAVHDSSGRCLLFEC
RDRTMHRLAPSEPCPELDCAESEQIVLNDRCCKVCRGHDFCSEGHGCMEHSDCVNLEAGG
CCACKDGFRPLRDDNAYCEDIDECAEGKHYCRENTMCVNTPGSFMCICHTGYIRIDDYSC
TEHDECLSGQHNCDKNALCFNMVGGHSCSCKPGYTGNGTVCKAMCDGLCQNGGTCVSPNN
CVCQQGFTGKRCETDIDECADGFVECDSKSTCVNLPGWYHCECRDGYHDNGLFSTNGESC
VDINECKTGRNTCANDTVCFNLDGGYDCRCPHGHNCTGDCIHDGKVKHSGQIWVLDSDRC
SVCSCQAGQVMCRRMVCDCDNPNADLFCCPECDPRLSSQCMHQNGLLTYGSGDTWVENCQ
QCQCLQGQVDCWPLPCPPVDCEFTVVPEGECCPRCITDPCQADTIRNDITKTCTDEHSIS
RFSGSSWIKHGTECTLCQCKNGHICCSVDPMCL
Download sequence
Identical sequences H2V0I9
ENSTRUP00000042719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]