SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000042720 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000042720
Domain Number 1 Region: 28-224
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.62e-42
Family Laminin G-like module 0.0016
Further Details:      
 
Domain Number 2 Region: 376-528
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000392
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 3 Region: 264-327
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000596
Family VWC domain 0.015
Further Details:      
 
Domain Number 4 Region: 685-756
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000994
Family VWC domain 0.0093
Further Details:      
 
Domain Number 5 Region: 551-611
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000653
Family EGF-type module 0.014
Further Details:      
 
Domain Number 6 Region: 517-557
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000544
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000042720
Domain Number - Region: 602-635
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00148
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 330-394
Classification Level Classification E-value
Superfamily FnI-like domain 0.00251
Family Fibronectin type I module 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000042720   Gene: ENSTRUG00000016697   Transcript: ENSTRUT00000042864
Sequence length 810
Comment pep:known_by_projection scaffold:FUGU4:scaffold_2:3112941:3156425:1 gene:ENSTRUG00000016697 transcript:ENSTRUT00000042864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRITTHFSLRVCNQVLGFGVDPALRISVFDELTLGEGFDGVTQVQGFHSESRAFHFQGSS
REVVAPTDVSEHMIRKLRGKNEFTVLVTLKQDHLNSGVVLSIHHSEHRFLELESSGQRSE
VRLHYRTRGQQAHTEVFPYSLADDQWHKVSVAVSASHVILHVDCNRIYERVVEAPYMDIP
EDASFWLGQRNAAHGFFKGVMQDVEILVMPQGYISQCPDLNRTCPTCNDFHGLVQKIMEL
QDVLAKTSSKLSRAEEKMNGLEGCYCERTCSVKGVIYREDEGWTDGCRNCTCSNGTVQCE
AISCPPPQCPAGTAPAYVKGACCKECQLICQFGGRELVEGDQKAVHDSSGRCLLFECRDR
TMHRLAPSEPCPELDCAESEQIVLNDRCCKVCRGHDFCSEGHGCMEHSDCVNLEAGGCCA
CKDGFRPLRDDNAYCEDIDECAEGKHYCRENTMCVNTPGSFMCICHTGYIRIDDYSCTEH
DECLSGQHNCDKNALCFNMVGGHSCSCKPGYTGNGTVCKAMCDGLCQNGGTCVSPNNCVC
QQGFTGKRCETDIDECADGFVECDSKSTCVNLPGWYHCECRDGYHDNGLFSTNGESCVDI
NECKTGRNTCANDTVCFNLDGGYDCRCPHGHNCTGDCIHDGKVKHSGQIWVLDSDRCSVC
SCQAGQVMCRRMVCDCDNPNADLFCCPECDPRLSSQCMHQNGLLTYGSGDTWVENCQQCQ
CLQGQVDCWPLPCPPVDCEFTVVPEGECCPRCITDPCQADTIRNDITKTCTDEHSISRFS
GSSWIKHGTECTLCQCKNGHICCSVDPMCL
Download sequence
Identical sequences H2V0J0
ENSTRUP00000042720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]