SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000042901 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000042901
Domain Number 1 Region: 53-517
Classification Level Classification E-value
Superfamily Sema domain 1.57e-149
Family Sema domain 0.000000115
Further Details:      
 
Domain Number 2 Region: 513-560
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000117
Family Plexin repeat 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000042901   Gene: ENSTRUG00000016754   Transcript: ENSTRUT00000043046
Sequence length 1000
Comment pep:known_by_projection scaffold:FUGU4:scaffold_7:2980866:3056424:-1 gene:ENSTRUG00000016754 transcript:ENSTRUT00000043046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSEALLLYFTLLQIAGAGFPEDSEPISISHSNYTKQYPAFVGHKPGRNNTQRHKLDIQL
IMIMNRTLYIAARDHIYTVDTDADGSDEIFFSKKMTWKSRQADVDTCRMKGKHKDECHNF
IKVLLQQNEDTLFVCGTNAFNPSCRTYKMDTLEALGEEISGMARCPYDAKHANVALFANG
KLYSATVTDFLAIDAVIYRSLGDSPTLRTVKHDSKWLKEPYFVQAVNYGDFIYFFYREIA
MEYNTMGKVVFPRVARVCKNDRGGSPRVLEKQWTSFLKSRLNCSIPGDSHFYFNILQAVT
DVIHINGKDVVMATFSTPYNSIPGSAVCAYDMAEVANTFTGRFKEQKSPDSTWTPFPEEK
VPKPRPGNCAGTPSMERYKVSNEFPDDTLNFIKMHPLMDEAVPSIANRPWFLKTMVRYRL
TRIVVDNEAGPYKNHTVVFLGSEKGIILKFLANMNNGFLNDSVFLEELNVYNPDKCSIDG
VDDKRIVGMQIDGKSHSLWVAFTSCVVKVPVSRCERHGRCKKSCIASRDPYCGWVAEGAC
RKVVGNIKSAFEQDVEHGNTDGLGDCQNTFVALNVKVDAPRSALPEAAEGPLGRGRMVEQ
KELPMSPPVSVSSLPFSAGVIRGSYQKPDQLVPVTLLAIAVILAFAMGAIFSGIIVYCVC
DHRRRDVDMTGRKEKESHHLHARRGSMNSVTKLTGLFETQAKDGRPEAILTPLMHNGRLT
PNGKMLIKADQHHLDLTALPTPESTPMQPRRKPSRGSREWERNQNLINACTKDMPPIGSP
VISTDLPLRASPGHIPSVVVLPLPQHQHQLQPHLQSYQHEYVEQPHHSELSMAHAVMDDQ
GATLEYKTVKKPCHNLNIVDPDGVLPPRVPQREASLTVPPAVPQMGKRLEVHSSVYGLRK
GSASSASGSSALKKHNTNSSNSSQLARQHSFNRVETPPPAPQRVDSIQMTAQGISLSRQP
GMSSYGSLPRTGIKFLKPDVPPKPSVVSLSTKVKSSDSCT
Download sequence
Identical sequences H2V121
ENSTRUP00000042901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]