SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000043435 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000043435
Domain Number 1 Region: 210-224,340-621
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.28e-58
Family Nuclear receptor ligand-binding domain 0.0000526
Further Details:      
 
Domain Number 2 Region: 141-223
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.5e-30
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000043435   Gene: ENSTRUG00000016957   Transcript: ENSTRUT00000043580
Sequence length 632
Comment pep:known_by_projection scaffold:FUGU4:scaffold_2:3785375:3789018:1 gene:ENSTRUG00000016957 transcript:ENSTRUT00000043580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TANLKTIALLVLSQEDTDVKTVGESAFIIRMDGQTQRIQLVSADRIQIVTDQQTGQKIQI
VTALQPSSPGKQQFILTNADYSPGGKVIVAKQEGSPNKVILTSSDGSAVNQLLFASPDLA
GQQIQFVTEGSDQSGLVKPVVEYCVVCGDKASGRHYGAVSCEGCKGFFKRSIRKNLVYTC
RGSGECAINKLHRNRCQYCRLQRCIALGMKQDSVQCERKPVEVTAREKTLNCAASTEKIY
IRKNLCSPLAATPTFVTDKETVRSTSVLESSMLLNIQQPFSKLENTILIPTSPEKDDPSQ
GDLGTLANVVTSLGHLNKSSDDGNDLMGVETLSNGDSSMTDIQAEEQSASDITRAFDTLA
KALHPADSSAGESLEATMQLMSGDQSGPVVELEGSLLSDIHIPFKLVMPLPAPEYLNVNY
ICESASRLLFLSMHWARSIPAFQTLCGQDNDINLMKACWNELFALGMAQCSSIMNVGTIL
SAIINHLQTSLQEEKLSAERVKLVMEHIWRMQEFCNSMLKLSPDSYEYAYLKAIVLFSPA
DHPGIDNTPQIERFQEKAYMELQDYVTRTYPEDCYRLSKLLVRLPALRLISANVTEELFF
AGLIGNVQIDSIIPYILKMETTDYNSQTDSAV
Download sequence
Identical sequences H2V2K4
ENSTRUP00000043435 31033.ENSTRUP00000043435 ENSTRUP00000043435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]